PDBID: | 8pt0 | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU75 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt1 | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU76 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt3 | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU77 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt5 | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU187 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt8 | Status: | HPUB -- hold until publication | Title: | JNK1 covalently bound to RU135 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt9 | Status: | HPUB -- hold until publication | Title: | JNK1 covalently bound to BD838 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pta | Status: | HPUB -- hold until publication | Title: | JNK1 covalently bound to BD837 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8ptd | Status: | HPUB -- hold until publication | Title: | The surface-exposed lipo-protein of BtuG1 in complex with cyanocobalamin. | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | Deposition date: | 2023-07-14 |
|
PDBID: | 8ptf | Status: | HPUB -- hold until publication | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | Deposition date: | 2023-07-14 |
|
PDBID: | 8pts | Status: | HPUB -- hold until publication | Title: | human GUK1 in complex with compound AT8001 | Authors: | Zimberger, C., Canard, B., Ferron, F. | Deposition date: | 2023-07-14 | Sequence: | >Entity 1 MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
PDBID: | 8ptt | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-14 |
|
PDBID: | 8ptv | Status: | HPUB -- hold until publication | Title: | IPNS variant N252Q in complex with Fe and ACV under anaerobic conditions | Authors: | Rabe, P., Schofield, C.J. | Deposition date: | 2023-07-15 |
|
PDBID: | 8pu1 | Status: | HPUB -- hold until publication | Title: | Structure of the toxin/antitoxin complex FaRel/ATfaRel2 with APCPP | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu2 | Status: | HPUB -- hold until publication | Title: | Structure of the antitoxin ATfaRel2 | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu3 | Status: | HPUB -- hold until publication | Title: | Complex of the toxin/antitoxin FaRel2/ATfaRel2 | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu4 | Status: | HPUB -- hold until publication | Title: | FaRel2 bound to the ATP analogue, APCPP | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Acyl-CoA dehydrogenase FadE1(PA0506) E441A from Pseudomonas aeruginosa complexed with C16CoA | Authors: | Wang, M., Brear, P., Welch, M. | Deposition date: | 2023-07-16 | Release date: | 2025-01-16 |
|
PDBID: | 8puj | Status: | HPUB -- hold until publication | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | Authors: | Whittaker, J., Martinez-Felices, J.M., Guskov, A., Slotboom, D.J. | Deposition date: | 2023-07-17 |
|
PDBID: | 8puk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8pul | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8pup | Status: | HPUB -- hold until publication | Title: | Influenza A/California/07/2009(H1N1) endonuclease in complex with purpurogallin-like compound | Authors: | Kotacka, T., Radilova, K. | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8puu | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8puv | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 |
|
PDBID: | 8puz | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 |
|
PDBID: | 8pv0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 |
|