PDBID: | 9bw6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bw7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bw8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-21 |
|
PDBID: | 9bw9 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwa | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Transport and Golgi Organization protein 2 Homolog (TANGO2) | Authors: | Lovell, S., Cooper, A., Powers, A., Battaile, K.P., Mohsen, A.-W., Ghaloul-Gonzalez, L. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwb | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwc | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwd | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwe | Status: | HPUB -- hold until publication | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine at pH 6.4 in an intermediate state | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwf | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwg | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwi | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwj | Status: | HPUB -- hold until publication | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine and 0.1 mM zinc in an apo state | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwl | Status: | PROC -- to be processed | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp in complex with butyryl-coA | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwm | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bwn | Status: | HPUB -- hold until publication | Title: | Nanoparticle Crystal Structure of a Thermostabilized Mutant Rv1498A Flavoprotein from Mycobacterium tuberculosis | Authors: | Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Delany, I., Cozzi, R. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwo | Status: | PROC -- to be processed | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetyl-coA | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwp | Status: | PROC -- to be processed | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetoacetyl-coA. | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwq | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bwr | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bws | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwt | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwu | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-21 |
|