| PDBID: | 8wj3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wj4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS bound to AMP | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wj5 | | Status: | HPUB -- hold until publication | | Title: | Double-wing domain of E. coli YdcD | | Authors: | Kamata, K., Tame, J.R.H. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS bound to an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wj7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with pyrrolysine and an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wj8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with BocK and an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wj9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with MeHis and an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wja | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with LmBrPhe and an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wjc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-25 | | Release date: | 2024-09-25 |
|
| PDBID: | 8wjd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-25 | | Release date: | 2024-09-25 |
|
| PDBID: | 8wje | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-25 | | Release date: | 2024-09-25 |
|
| PDBID: | 8wjf | | Status: | HPUB -- hold until publication | | Title: | Unlocking Immunogenic Potential: Innovating a Peptide/Ferritin Fusion Tag Nano-Delivery Platform from de novo design to Significantly Enhance Antigenicity of the Rabies Virus Glycoprotein Domain III | | Authors: | Fu, D., Wang, M., Guo, Y. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wjg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8wjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wji | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wjk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 | | Sequence: | >Entity 1
ESPSGYIKKVILRNFMCHEHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSLKDLIREGCYSAKIILHLDNSKYGAYQQGIFGNEIIVERIIKRDGPASFSLRSENGKEISNKKKDIQTVVDYFSVPVSNPMCFLSQDAARSFLTASTSQDKYSHFMKGTLLQEITENLLYASAIHDSAQENMALHLENLKSLKAEYEDAKLNQTSDLNERKMLLQAKSLWIDVAHNTDAAALKEGIQRQIQNACAFCSKERIENVDLPDTQEEIKRELDKVSRMIQKAEKSLGLSQEEVIALFEKCRNKYKEGQKKYMEIDEALNRLHNSLKARDQNYKNAEKGTCFDADMDFRASLKVRKFSGNLSFIKDTKSLEIYILTTNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIARTQTIIITPQDIGKIADIDSSGVSIHRMRDP
>Entity 2
PDLSSFQPGSIIKIRLQDFVTYTLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFIKNGQDVSKIEITLKNSPNVTDIEYIDARDETIKITRIITRSKRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDASLLDVLDELRELQGNEQSLQKDLDFKKAKIVHLRQESDKLRKSVESLRDFQNKKGQLLPYVKVKDHKEKLNVKEMRDTPEFQSWMREIRSYDQDTKEKLNKVAEKYEEEGNFNLSFVQDVLDKLESEIAMVNHDESAVTILDQVTAELRELEHTVPQQSKDLETIKAKLKEDHAVLEPKLDDIVSKISARFARLFNNVGSAGAVRLEKPKDYAEWKIEIMVKFRDNAPLKKLDSHTQSGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFLITPKLLTGLHYHEKMRIHC
>Entity 3
PVTGDATAKYLLQYILSARGICHENALILALMRLETDASTLNTEWSIQQWVDKLNDYINAINVKLNLLGYKIIRINHGIGRNAVTLKAKQNFEDYAVLQSIVLPESNRFFVYVNLASAEETKLATRFNQNEIEFMKWAIEQFMISGETIVEGPALETSIIVKEVNRILVAATGDSNLAKWRKFSTFTVGSTNLFQFQELTATDIEDLLLRLCELKWFYRTQEGKFGIDLRCIAELEEYLTSMYNLNTCQNCHKLAIQGVRCGNESCREENEETGENSLSQIWHVDCFKHYITHVSKNCDRCGSSLITEGVYVI
>Entity 4
DLTEDLAVAKIVKENPVARKMVRYILSRGESQNSIITRNKLQSVIHEAAREENIAKPSFSKMFMDINAILYNVYGFELQGLPSKNNMEPLGHRAQKFILLNNVPHSKNFDDFKILQSAHTYEELIVTGEYIGDDIASGTSNTLESKLSTDRDLVYKGVLSVILCIVFFSKNNILHQELIKFLETFGIPSDGSKIAILNITIEDLIKSLEKREYIVRLEEKSDTDGEVISYRIGRRTQAELGLESLEKLVQEIMGLEKEQTKSLHDDIIKSIGDSYSI
>Entity 5
SKDGDPQLEFKVLQGYRDLESEMHKGRAQVTRTGDIGVAMDNLNAVDSLFNKVIGIKNNGLFAHDARAMVSISELAQISVRNLKFDDSRSMVNLENIVNSLKRYMLKEHFKLNNIAENRNDTSMRHSYLQQFSHYNEFSQFNWFRIGALYNTISKNAPITDHLMGPLAICFKKLSKKLGPEGSINLFKFIIDPNSFSRSIENLFYTSFLIKEGKLLMEHDEEGLPTIKIKQSISHTDSRSKEIERQRRRAAHQNHIIFQMDMPTWRKLIKKYNITSPFLD
|
|
| PDBID: | 8wjp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wjr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wjs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with AllocK and an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wjt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with CbzK and an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wju | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with DmBrPhe and an ATP analogue | | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8wjv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of T2R-TTL-IKP104-Colchicine | | Authors: | Yang, J.H., Yang, J.H. | | Deposition date: | 2023-09-26 | | Release date: | 2024-09-26 |
|
