PDBID: | 8vrt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8vrl | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium smegmatis 50S ribosomal subunit bound to HflX and chloramphenicol:50S-HflX-A-Clm | Authors: | Majumdar, S., Koripella, R.K., Sharma, M.R., Manjari, S.R., Banavali, N.K., Agrawal, R.K. | Deposition date: | 2024-01-22 |
|
PDBID: | 8vry | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8xz9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 2 ACE2) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 8xz8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 1 ACE2) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzc | Status: | HPUB -- hold until publication | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (PM20D2) Tyr314Phe mutant | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzu | Status: | HPUB -- hold until publication | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.33 angstrom resolution | Authors: | Manjunath, K., Goswami, A. | Deposition date: | 2024-01-21 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 8xzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8y01 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Medium-wave-sensitive opsin 1 | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | Deposition date: | 2024-01-21 | Release date: | 2025-01-21 |
|
PDBID: | 8y02 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Short-wave-sensitive opsin 1 | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | Deposition date: | 2024-01-21 | Release date: | 2025-01-21 |
|
PDBID: | 8xzv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xza | Status: | HPUB -- hold until publication | Title: | BA.2.86 Spike in complex with bovine ACE2 (Local refinement) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 8y00 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzx | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8rqy | Status: | AUTH -- processed, waiting for author review and approval | Title: | MakC from the mak operon of Vibrio cholerae | Authors: | Bodra, N., Persson, K. | Deposition date: | 2024-01-21 |
|
PDBID: | 8vrc | Status: | HPUB -- hold until publication | Title: | Tetrahymena thermophila MLP1 RRM domain | Authors: | Donaldson, L.W. | Deposition date: | 2024-01-21 | Release date: | 2024-09-19 | Sequence: | >Entity 1 TFQPIIFSTACEQEGVANWRNITEALLKQHNVHAPYCRFGKLEGNFALNKDKTSQEVIDQLVQDGLQFGESKVTIKVSEGEALSKFWELHGRHYNGVMEL
|
|
PDBID: | 8vrf | Status: | HPUB -- hold until publication | Title: | Sucrose-phosphate synthase-like protein from Leishmania major | Authors: | Gorman, M.A., Parker, M.W., McConville, M.J. | Deposition date: | 2024-01-21 |
|
PDBID: | 8xyv | Status: | HPUB -- hold until publication | Title: | De novo designed protein 0705-5 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyr | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-2 | Authors: | Liu, L.J., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xys | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-1 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyu | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-3 | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyw | Status: | HPUB -- hold until publication | Title: | De novo designed protein Trx-3 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|