| PDBID: | 8xso | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8xst | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xss | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xsh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8xsg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8xsd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BA.5 RBD in complex with CR9 | | Authors: | Feng, L.L. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8xsc | | Status: | HOLD -- hold until a certain date | | Title: | PPAT in complex with Ppant | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xsn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8xsk | | Status: | HOLD -- hold until a certain date | | Title: | crystal structure of PPAT | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk6 | | Status: | HPUB -- hold until publication | | Title: | Amide-linked, extended 14alpha-demethylase (CYP51) with antifungal azole inhibitor | | Authors: | Tyndall, J.D.A., Monk, B.C., Simons, C. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjz | | Status: | HPUB -- hold until publication | | Title: | HLA-A*03:01 with WT KRAS-10mer | | Authors: | Sim, M.J.W., Sun, P.D. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 | | Sequence: | >Entity 1
MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2
MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
| PDBID: | 8xs1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrq | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | | Authors: | Liu, C.C., Ju, B., Zhang, Z. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrr | | Status: | HPUB -- hold until publication | | Title: | A complex structure of PDGFRA with an inhibitor RH140 | | Authors: | Zhu, S.J., Bi, S.Z. | | Deposition date: | 2024-01-08 |
|
