| PDBID: | 7h6d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.64 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 1-[(8-methylnaphthalen-1-yl)methyl]indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 2.0 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 5-fluoro-3-methyl-N-(2-methylsulfonyl-4-pyridin-4-ylphenyl)-1-benzothiophene-2-sulfonamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.25 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-[2-(dimethylamino)-2-oxoethyl]-1-[(5-fluoro-1-benzothiophen-3-yl)methyl]indole-2-carboxylic acid (INDOLE 2-CARBOXYLIC ACID) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.21 A CRYSTAL STRUCTURE OF HUMAN CATHEPSIN G IN COMPLEX WITH N-[2-[6-fluoro-2-[(4-hydroxy-5-methyl-2-oxo-5-phenylfuran-3-yl)-phenylmethyl]-1H-indol-3-yl]ethyl]acetamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.94 A CRYSTAL STRUCTURE OF HUMAN CATHEPSIN G IN COMPLEX WITH 1-[(7-fluoronaphthalen-1-yl)methyl]-3-[[methoxycarbonyl(methyl)amino]methyl]indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 2.10 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 5-fluoro-3-(methanesulfonamidomethyl)-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 2.17 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH methyl 4-[(5-fluoro-3-methyl-1-benzothiophen-2-yl)sulfonylamino]-3-methylsulfonylbenzoate (TOA EIYO INHIBITOR) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.68 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-[2-(dimethylamino)-2-oxoethyl]-5-fluoro-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid (2-carboxy indole) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.60 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 1-(2-methoxyethyl)-3-(naphthalen-1-ylmethyl)indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z5h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the hGPR68-Gs complex in pH6.0 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z68 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR68-Gs complex in pH6.8 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z65 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR4-Gs complex in pH7.2 | | Authors: | Zhong, Y.N., Guo, L.L. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z66 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the receptor of hGPR4-Gs complex in pH7.2 | | Authors: | Zhong, Y.N., Guo, L.L. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5b | | Status: | HPUB -- hold until publication | | Title: | The X-Ray crystal structure of multicopper oxidase from Bacillus freudenreichii | | Authors: | Qian, H., Wang, Y. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z59 | | Status: | HPUB -- hold until publication | | Title: | The X-Ray crystal structure of multicopper oxidase from Sulfurimonas sp. | | Authors: | Wang, Y., Qian, H. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z67 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR68-Gs complex in pH6.8 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z55 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SIRT5 in complex with succPrx1 and ADP ribose | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8z56 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITLNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
