| PDBID: | 8yvs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8yvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8yvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b8b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b8c | | Status: | HPUB -- hold until publication | | Title: | RM018 Fab in complex with Apex GT 6.2 trimer and RM20A3 Fab | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b8f | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with Lys1269Ala and His1271Ala substitutions in the coatomer binding motif, 2RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b8g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b87 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b8a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b88 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b89 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human ADAR1 in complex with dsRNA derived from HT2C gene in the pre-editing state | | Authors: | Deng, X., Gao, Y. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9evg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9evf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9evd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9evh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9eve | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ARM domain of human ZNFX1 | | Authors: | Grabarczyk, D.B., Deszcz, L., Clausen, T. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8yvi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yve | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvf | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 | | Sequence: | >Entity 1
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2
MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3
RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
| PDBID: | 8yv7 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Thialysine N-epsilon-acetyltransferase from Caenorhabditis elegans | | Authors: | Wang, N., Ma, X. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yv9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8yva | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8yvb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8yvo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2639-2707 bound to C4.2 nanobody | | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | | Deposition date: | 2024-03-28 |
|
