PDBID: | 9bto | Status: | AUTH -- processed, waiting for author review and approval | Title: | Influenza hemagglutinin B/Maryland/2016 glycoprotein | Authors: | Torrents de la Pena, A., Sewall, L.M., Ward, A.B. | Deposition date: | 2024-05-15 |
|
PDBID: | 9btv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of rhesus antibody T646-a.01 in complex with HIV-1 Env Q23.17 MD39 SOSIP | Authors: | Roark, R.S., Shapiro, L., Kwong, P.D. | Deposition date: | 2024-05-15 |
|
PDBID: | 9btr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-C-163 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 9bts | Status: | HPUB -- hold until publication | Title: | Crystal structure of the bacterioferritin (Bfr) and ferritin (Ftn) heterooligomer complex from Acinetobacter baumannii | Authors: | Lovell, S., Liu, L., Battaile, K.P., Rivera, M. | Deposition date: | 2024-05-15 |
|
PDBID: | 9btt | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-B-51T | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 9btu | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-05-15 |
|
PDBID: | 9btx | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9bty | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9btz | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9bte | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor CID5573_0017 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 9btl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-15 |
|
PDBID: | 9bu0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | HEN EGG-WHITE Lysozyme incubated at 87% relative humidity | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | HEN EGG-WHITE Lysozyme incubated at 60% relative humidity | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc9 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-15 |
|
PDBID: | 9fca | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-15 |
|
PDBID: | 9fcb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-15 |
|
PDBID: | 9fcj | Status: | AUTH -- processed, waiting for author review and approval | Title: | USP1 bound to ML323 and ubiquitin conjugated to FANCD2 (ordered subset, focused refinement) | Authors: | Rennie, M.L., Gundogdu, M., Walden, H. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fci | Status: | AUTH -- processed, waiting for author review and approval | Title: | USP1 bound to KSQ-4279 and ubiquitin conjugated to FANCD2 (focused refinement) | Authors: | Rennie, M.L., Gundogdu, M., Walden, H. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fct | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 9fcm | Status: | AUTH -- processed, waiting for author review and approval | Title: | Single-domain antibody binding the SARS-COV2 S2 | Authors: | Vann Molle, I., Remaut, H. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fce | Status: | HPUB -- hold until publication | Title: | BelI in complex with SAM from Streptomyces sp. UCK14 | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | Deposition date: | 2024-05-15 | Sequence: | >Entity 1 GSAQTFEIKGNDLWDPTTFDALRRQLIPSFDLIYEAAVRTVAATVPTAPRVLDLGAGTGLLSAAILRELPDSEVVLVDRSELMLTQARGRFASQDGVTVQTGDLTDPLPEGGFDAVVSGLAIHHLSHTGKRDLFRRIREALRPGGVFVNVEQVQGPLPHLESLYDSQHELHVIREQAPAHEWAAGRERMKFDVCIDLETQLQWLRDAGFRSVDCLAKDFRFATYAGWVS
|
|
PDBID: | 9fbz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Dye-decolourising peroxidase DtpB mixed with hydrogen peroxide for 1.3 s | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Owen, R.L., Devenish, N. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Dye-decolourising peroxidase DtpB mixed with hydrogen peroxide for 2.7 s | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Owen, R.L., Devenish, N. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Dye-decolourising peroxidase DtpB mixed with hydrogen peroxide for 6.7 s | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Owen, R.L., Devenish, N. | Deposition date: | 2024-05-15 |
|