PDBID: | 9gbo | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG16 | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbp | Status: | HPUB -- hold until publication | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG3 | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbf | Status: | HOLD -- hold until a certain date | Title: | X-RAY structure of PHDvC5HCH tandem domain of NSD2 | Authors: | Musco, G., Cocomazzi, P., Berardi, A., Knapp, S., Kramer, A. | Deposition date: | 2024-07-31 | Release date: | 2025-07-31 |
|
PDBID: | 9gbh | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND1 | Authors: | Schaefer, M., Fuerstner, C., Ackerstaff, J., Meier, H., Straub, A., Mittendorf, J., Schamberger, J., Boerngen, K., Joerissen, H., Zubow, D., Zimmermann, K., Tersteegen, A., Geiss, V., Hartmann, E., Albrecht-Kuepper, B., Dorleans-Juste, P., Lapointe, C., Vincent, L., Heitmeier, S., Tinel, H. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG15 | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG17 | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbt | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbi | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbg | Status: | HPUB -- hold until publication | Title: | Putative Phage Recombinase UvsX | Authors: | Freitag-Pohl, S., Pohl, E. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbw | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbz | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9gc0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbj | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-07-31 | Release date: | 2025-07-31 |
|
PDBID: | 9gbs | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG18 | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gby | Status: | HPUB -- hold until publication | Title: | Crystal structure of Pseudomonas aeruginosa IspD | Authors: | Borel, F., D''Auria, L. | Deposition date: | 2024-07-31 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
PDBID: | 9gbu | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9iyw | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9iz8 | Status: | HPUB -- hold until publication | Title: | fungal unspecific peroxygenase from Thielavia terrestris | Authors: | Lai, M.Y., Yu, H.L. | Deposition date: | 2024-07-31 |
|
PDBID: | 9iz1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | dmCTPS tetramer with dATP dUTP dGTP and DON | Authors: | Guo, C.J., Liu, J.L. | Deposition date: | 2024-07-31 |
|
PDBID: | 9iz2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Focus refinement dmCTPS bound with dATP dUTP dGTP and DON | Authors: | Guo, C.J., Liu, J.L. | Deposition date: | 2024-07-31 |
|
PDBID: | 9iyz | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9iyq | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9iyp | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9iz3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|
PDBID: | 9iym | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|