| PDBID: | 8yvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8bks | | Status: | HPUB -- hold until publication | | Title: | Carboxymyoglobin photolysis time series (5 mJ/cm2 fluence): 604 fs time delay | | Authors: | Barends, T., Schlichting, I. | | Deposition date: | 2022-11-09 | | Release date: | 2024-05-15 | | Sequence: | >Entity 1
GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQ
|
|
| PDBID: | 8toa | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of H7 hemagglutinin from A/Shanghai2/2013 H7N9 in complex with a human neutralizing antibody H7.HK2 | | Authors: | Morano, N.C., Becker, J.E., Wu, X., Shapiro, L. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 2cx2 | | Status: | WDRN -- deposition withdrawn | | Title: | CYCLOOXYGENASE-2 (PROSTAGLANDIN SYNTHASE-2) COMPLEXED WITH A BENZYL-INDOLE INHIBITOR, L-758048 | | Authors: | McKeever, B.M., Pandya, S.R., Percival, M.D., Ouellet, M., Bayly, C., O''Neill, G.P., Bastien, L., Kennedy, B.P., Adam, M., Cromlish, W., Roy, P., Black, W.C., Guay, D., Leblanc, Y. | | Deposition date: | 1998-04-24 |
|
| PDBID: | 3zh1 | | Status: | POLC -- waiting for a policy decision | | Title: | Structural model of the complex between H3K36 methylated nucleosomes and the PSIP1-PWWP domain. | | Authors: | van Ingen, H., van Nuland, R., Timmers, H.T.M., Boelens, R. | | Deposition date: | 2012-12-20 |
|
| PDBID: | 6aev | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of RhoA with covalent inhibitor DCRhoin06 | | Authors: | Zhang, H., Luo, C. | | Deposition date: | 2018-08-06 |
|
| PDBID: | 8yvy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Semliki Forest virus viron | | Authors: | Zheng, T. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 1wyf | | Status: | WDRN -- deposition withdrawn | | Title: | ATP-dependent DNA ligase from Pyrococcus furiosus | | Authors: | Nishida, H., Ishino, Y., Morikawa, K. | | Deposition date: | 2005-02-14 |
|
| PDBID: | 6aew | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of RhoA with covalent inhibitor DCRhoin07 | | Authors: | Zhang, H., Luo, C. | | Deposition date: | 2018-08-06 |
|
| PDBID: | 8bku | | Status: | HPUB -- hold until publication | | Title: | Carboxymyoglobin photolysis time series (5 mJ/cm2 fluence): 702 fs time delay | | Authors: | Barends, T., Schlichting, I. | | Deposition date: | 2022-11-09 | | Release date: | 2024-05-15 |
|
| PDBID: | 8toj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 3w3i | | Status: | WDRN -- deposition withdrawn | | Title: | The complex structure of Rv3378c-Y51F with TPP | | Authors: | Chan, H.C., Ko, T.P., Feng, X., Liu, W., Zheng, Y., Huang, C.H., Hu, Y., Bogue, S., Nakano, C., Hoshino, T., Zhang, L., Lv, Pin, Liang, P.H., Wang, H.-J., Oldfield, E., Guo, R.T. | | Deposition date: | 2012-12-21 |
|
| PDBID: | 8yvz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Semliki Forest virus viron | | Authors: | Zheng, T. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 3zhj | | Status: | WDRN -- deposition withdrawn | | Title: | N-terminal domain of the CI repressor from bacteriophage TP901-1 | | Authors: | Frandsen, K.H., Rasmussen, K.K., Poulsen, J.N., Lo Leggio, L. | | Deposition date: | 2012-12-21 |
|
| PDBID: | 1zr1 | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of FGF-1, S17T/N18T/G19 deletion mutant | | Authors: | Lee, J., Blaber, M. | | Deposition date: | 2005-05-18 |
|
| PDBID: | 8tog | | Status: | HPUB -- hold until publication | | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | | Deposition date: | 2023-08-03 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8bkt | | Status: | HPUB -- hold until publication | | Title: | Carboxymyoglobin photolysis time series (5 mJ/cm2 fluence): 627 fs time delay | | Authors: | Barends, T., Schlichting, I. | | Deposition date: | 2022-11-09 | | Release date: | 2024-05-15 |
|
| PDBID: | 6aey | | Status: | WDRN -- deposition withdrawn | | Title: | THRb mutation with a novel agonist | | Authors: | Yao, B.Q., Li, Y. | | Deposition date: | 2018-08-07 |
|
| PDBID: | 8yw0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Semliki Forest virus viron | | Authors: | Zheng, T. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 3w3p | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure 1 | | Authors: | Hakoshima, T. | | Deposition date: | 2012-12-27 |
|
| PDBID: | 6af8 | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of BphC, a halotolerant catechol dioxygenase | | Authors: | Thakur, K.G., Solanki, V. | | Deposition date: | 2018-08-08 | | Release date: | 2019-11-15 |
|
| PDBID: | 2dih | | Status: | WDRN -- deposition withdrawn | | Title: | M. TUBERCULOSIS DIHYDRODIPICOLINATE REDUCTASE IN COMPLEX WITH NADH AND THE INHIBITOR 2,6 PYRIDINE DICARBOXYLATE | | Authors: | Scapin, G., Zheng, R., Blanchard, J.S. | | Deposition date: | 1998-08-25 |
|
| PDBID: | 8bkv | | Status: | HPUB -- hold until publication | | Title: | Carboxymyoglobin photolysis time series (5 mJ/cm2 fluence): 847 fs time delay | | Authors: | Barends, T., Schlichting, I. | | Deposition date: | 2022-11-09 | | Release date: | 2024-05-15 |
|
| PDBID: | 8to7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8yw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Semliki Forest virus viron in complex with VLDLR | | Authors: | Zheng, T. | | Deposition date: | 2024-03-29 |
|
