| PDBID: | 9etc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
| PDBID: | 9etd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with ursodeoxycholic acid | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
| PDBID: | 9ete | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with deoxycholic acid | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
| PDBID: | 9esa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9es8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9eru | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mouse CNPase catalytic domain with nanobody 7E | | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | | Deposition date: | 2024-03-25 | | Release date: | 2025-03-25 |
|
| PDBID: | 8ytc | | Status: | HPUB -- hold until publication | | Title: | PML-RBCC dimer | | Authors: | Tan, Y.T., Li, J.L. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8yt8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8ytb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 empty particle | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8yta | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of PDE8A with 1604R | | Authors: | Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8ytg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8yt9 | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8yt6 | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8ytf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8yt7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the MAM domain of Spodoptera frugiperda Scavenger Receptor-C | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8yth | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9b6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9b6m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-25 | | Release date: | 2025-03-25 |
|
| PDBID: | 9b6n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab1-1 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9b6p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab1-3 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9b6q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab1-4 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9b6r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab1-5 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9b6t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab1-7 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9b6c | | Status: | HPUB -- hold until publication | | Title: | Human asparagine synthetase Arg-142 to Ile-142 (R142I) variant | | Authors: | Coricello, A., Nardone, A., Lupia, A., Gratteri, C., Vos, M., Chaptal, V., Alcaro, S., Zhu, W., Takagi, Y., Richards, N. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9b6o | | Status: | HPUB -- hold until publication | | Title: | Fab1-2 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-25 |
|
