| PDBID: | 8ejt | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Kelch domain of human KEAP1 bound to Nrf2 linear peptide, Ac-(DhA)DPETGE-NH2 | | Authors: | Muellers, S.N., Allen, K.N. | | Deposition date: | 2022-09-18 |
|
| PDBID: | 1y05 | | Status: | WDRN -- deposition withdrawn | | Title: | Solution structure of the B-linker of dmpR | | Authors: | Tengel, T., Lundqvist, M., Sethson, I., Schingler, V. | | Deposition date: | 2004-11-15 |
|
| PDBID: | 8zs4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-05 |
|
| PDBID: | 3scb | | Status: | WDRN -- deposition withdrawn | | Title: | X-ray crystal structure of E. coli YdiI complexed with undeca-2-one-CoA | | Authors: | Allen, K.N., Dunaway-Mariano, D., Wu, R., Chen, D. | | Deposition date: | 2011-06-07 | | Release date: | 2012-12-19 |
|
| PDBID: | 5zmx | | Status: | WDRN -- deposition withdrawn | | Title: | Structure of terminal oxygenase in carbazole 1,9a-dioxygenase with carbazole and oxygen | | Authors: | Wang, Y.X., Suzuki-Minakuchi, C., Nojiri, H. | | Deposition date: | 2018-04-06 |
|
| PDBID: | 8v17 | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer with inhibitor bound - exploration of a benzothiazole | | Authors: | Goldstone, D.C., Walsham, L.J. | | Deposition date: | 2023-11-19 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 1wk7 | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of TT0836 in complex with sinefungin | | Authors: | Kaminishi, T., Sakai, H., Takemoto-Hori, C., Terada, T., Nakagawa, N., Maoka, N., Kuramitsu, S., Shirouzu, M., Yokoyama, S. | | Deposition date: | 2004-05-30 |
|
| PDBID: | 8v1n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of tau filaments made from jR2R3-P301L peptides induced with heparin | | Authors: | Vigers, M., Han, S. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 5yqk | | Status: | WDRN -- deposition withdrawn | | Deposition date: | 2017-11-07 | | Release date: | 2019-03-07 |
|
| PDBID: | 8ioq | | Status: | WDRN -- deposition withdrawn | | Deposition date: | 2023-03-13 | | Release date: | 2024-05-16 |
|
| PDBID: | 8zs5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-05 |
|
| PDBID: | 3zmx | | Status: | WDRN -- deposition withdrawn | | Title: | H5 Haemagglutinin (VN1194) in Complex with Sulfated Sialyl-Lewis X | | Authors: | Xiong, X., Tuzikov, A., Coombs, P., Martin, S.R., Walker, P.A., Gamblin, S.J., Bovin, N., Skehel, J.J. | | Deposition date: | 2013-02-13 |
|
| PDBID: | 8iop | | Status: | WDRN -- deposition withdrawn | | Deposition date: | 2023-03-13 | | Release date: | 2024-03-13 |
|
| PDBID: | 1srw | | Status: | WDRN -- deposition withdrawn | | Title: | Human Cytosolic deoxyribonucleotidase | | Authors: | Rinaldo-Matthis, A., Rampazzo, C., Reichard, P., Bianchi, V., Nordlund, P. | | Deposition date: | 2004-03-23 |
|
| PDBID: | 8zsj | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of the apo hTAAR1-Gs complex | | Authors: | Xu, F., Jiang, K.X., Zheng, Y. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 3slw | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of Mycobacterium tuberculosis PKS11 in complex with polyketide intermediates and evidence that it synthesize alkylpyrones | | Authors: | Gokulan, K., Sacchettini, J.C., Mycobacterium Tuberculosis Structural Proteomics Project (XMTB) | | Deposition date: | 2011-06-26 |
|
| PDBID: | 5uxl | | Status: | WDRN -- deposition withdrawn | | Title: | Structure of the Thermus thermophilus 30S ribosomal subunit complexed with a 2-thiocytidine and inosine modified Esherichia coli anticodon stem loop (ASL) of transfer RNA Arginine (TRNAARG) bound to an mRNA with a CGC-codon in the A-site and paromomycin | | Authors: | Cantara, W.A., DeMirci, H., Murphy IV, F.V., Agris, P.F. | | Deposition date: | 2017-02-23 |
|
| PDBID: | 8utj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-31 |
|
| PDBID: | 1zkv | | Status: | WDRN -- deposition withdrawn | | Title: | The Structure of the RegX3 response regulator from Mycobacterium tuberculosis | | Authors: | King-Scott, J.D., Nowak, E., Panjikar, S., Tucker, P.A. | | Deposition date: | 2005-05-04 |
|
| PDBID: | 8ise | | Status: | WDRN -- deposition withdrawn | | Deposition date: | 2023-03-20 |
|
| PDBID: | 8zs6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-05 |
|
| PDBID: | 5xml | | Status: | WDRN -- deposition withdrawn | | Title: | Cryo-EM structure of the ATP-bound VPS4 mutant-E233Q hexamer (unmasked) | | Authors: | Sun, S., Li, L., Yang, F., Wang, X., Fan, F., Li, X., Wang, H., Sui, S. | | Deposition date: | 2017-05-15 |
|
| PDBID: | 3w8c | | Status: | WDRN -- deposition withdrawn | | Title: | Not available | | Authors: | Nishii, W., Kukimoto-Niino, M., Terada, T., Shirouzu, M., Muramatsu, T., Yokoyama, S. | | Deposition date: | 2013-03-12 |
|
| PDBID: | 8vqg | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of Can f 1 | | Authors: | Khatri, K., Geoffrey, M.A., Pedersen, L.C., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8zsi | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-05 |
|
