| PDBID: | 8xu2 | | Status: | HPUB -- hold until publication | | Title: | DaCS-citrate complex | | Authors: | Yang, L.Y., Fang, Y.J. | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8xtw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8ro3 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the staked Photosystem II - LHCII supercomplex from Chlorella ohadi | | Authors: | Fadeeva, M., Klaiman, D., Caspy, I., Nelson, N. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8rnz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ro5 | | Status: | HPUB -- hold until publication | | Title: | HLA-A3 restricted mG12V-TCR | | Authors: | Sim, M.J.W., Sun, P.D. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl6 | | Status: | HPUB -- hold until publication | | Title: | HcG in complex within mini protein | | Authors: | Baohua, C., Rongsheng, J. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vl1 | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 36 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vle | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vld | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vln | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8vla | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtn | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Rab5b GTPase domain from Leishmania donovani in complex with GDP | | Authors: | Zohib, M., Pal, R.K., Biswal, B.K., Arora, A. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtq | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 2 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtp | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 4 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xts | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AaHPPD-Y14150 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-11 |
|
