| PDBID: | 9bdr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9bdo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anti-abTCR NANOBODY VHH | | Authors: | Qiu, Y. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bds | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-12 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9bdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdk | | Status: | HPUB -- hold until publication | | Title: | CP20.2 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9ezc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9eza | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 | | Release date: | 2025-04-11 |
|
| PDBID: | 9ez9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9ezd | | Status: | HPUB -- hold until publication | | Title: | BsmI (Bottom Nicking mutant) crystallized with Mg2+ and cognate dsDNA (Post-reactive complex) | | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9ezb | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant P67S | | Authors: | Dhamotharan, K., Schlundt, A., Guenther, S. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9eze | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | P ring on polyrod-P ring complex from Salmonella typhimurium HK26292 mutant | | Authors: | Yamaguchi, T., Kato, T., Minamino, T., Namba, K. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1h | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS main protease in complex with PF-00835231 | | Authors: | Lin, C., Zhang, J., Li, J. | | Deposition date: | 2024-04-11 | | Release date: | 2025-04-11 |
|
| PDBID: | 8z1q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human ELAC2-pre-tRNA | | Authors: | Liu, Z.M., Xue, C.Y. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human ELAC2-tRNA | | Authors: | Liu, Z.M., Xue, C.Y. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the isomerase Art22 | | Authors: | Guo, L., Li, P.W., Li, D.F., Chen, Y.H. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | isocitrate lyase MoMcl1 | | Authors: | Liu, X.H., Zhao, W.H. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
