| PDBID: | 9htc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 1600 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hts | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.19 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htv | | Status: | PROC -- to be processed | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.95 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hto | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hti | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hth | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of YIUA from Yersinia ruckeri with Iron and nitrilotriacetic acid | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hss | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with 1,4-oxazepane | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with cyanoacetamide | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with 4-bromopyrazole | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hs9 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (unclear crosslink from Lys), damage-free | | Authors: | Pfalzgraf, H.E., Adams, H.R., Sugimoto, H., Tosha, T., Horrell, S., Jaho, S., Beilsten-Edmands, J., Tews, I., Worrall, J.A.R., Owen, R.L., Hough, M.A. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsa | | Status: | HOLD -- hold until a certain date | | Title: | Solution structure of X55, a computationally designed protein | | Authors: | Schweimer, K., Hennig, J., Perez-Borrajero, C. | | Deposition date: | 2024-12-19 | | Release date: | 2025-01-16 | | Sequence: | >Entity 1
SMDKEWISKLPKSPEPWTPEQEEAFLKRFAEKVDPEETLKKLEEWIKENIKKYPEYKDELEVAYNSAKLFLESPLVEGPGKVRAIGRVLWTIKRLNIDSPFV
|
|
| PDBID: | 9ht8 | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type I collagen prolyl 4-hydroxylase complexed with Pro-Pro-Gly-Pro-Ala-Gly-Pro-Pro-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-19 |
|
