| PDBID: | 9mvg | | Status: | HPUB -- hold until publication | | Title: | Structure of SciW variant L66A bound to the Rhs1 transmembrane domain | | Authors: | Van Schepdael, M.A., Prehna, G. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mvj | | Status: | HPUB -- hold until publication | | Title: | anti-EGFR designed Fab | | Authors: | Kiefer, J.R., Frey, N.C., Alberstein, R.G., Seeger, F., Watkins, A.M., Gligorijevic, V., Dou, Y., Tang, Y., Regev, A., Bonneau, R. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mvl | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of feline coronavirus UU23 main protease with GC376 | | Authors: | Shaqra, A.M., Maryam, A., Schiffer, C.A. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0i | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9i0j | | Status: | HOLD -- hold until a certain date | | Title: | Structure of METTL21A (K215A mutant) bound to compound 16 | | Authors: | Peng, L., Metzger, E., Schuele, R. | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9i0x | | Status: | HOLD -- hold until a certain date | | Title: | Structure of METTL21A (K215A mutant) bound to compound (S)-29 | | Authors: | Peng, L., Metzger, E., Schuele, R. | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9i0p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CR57 diabody-2, a homospecific diabody with minimal linker | | Authors: | Kedari, A., Rissanen, I. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i14 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HCT15 POLYSOMES IN HYBRID-PRE STATE | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0f | | Status: | REFI -- re-refined entry | | Title: | Revisited AvNifEN crystal structure | | Authors: | Paya Tormo, L., Nguyen, T.Q., Fyfe, C., Basbous, H., Dobrzynska, K., Echavarri-Erasun, C., Martin, L., Caserta, G., Legrand, P., Thorn, A., Amara, P., Schoehn, G., Cherrier, M.V., Rubio, L.M., Nicolet, Y. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0g | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of holo-GmNifEN | | Authors: | Paya Tormo, L., Nguyen, T.Q., Fyfe, C., Basbous, H., Dobrzynska, K., Echavarri-Erasun, C., Martin, L., Caserta, G., Legrand, P., Thorn, A., Amara, P., Schoehn, G., Cherrier, M.V., Rubio, L.M., Nicolet, Y. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0h | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of transit-GmNifEN | | Authors: | Paya Tormo, L., Nguyen, T.Q., Fyfe, C., Basbous, H., Dobrzynska, K., Echavarri-Erasun, C., Martin, L., Caserta, G., Legrand, P., Thorn, A., Amara, P., Schoehn, G., Cherrier, M.V., Rubio, L.M., Nicolet, Y. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0s | | Status: | HPUB -- hold until publication | | Title: | Structure of RecQL-ADP complex from Bos taurus | | Authors: | Song, Z.Y., Liu, N.N., Ai, X., Rety, S., Xi, X.G. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0q | | Status: | HPUB -- hold until publication | | Title: | CK2alpha in complex with CX-4945 AND the alphaD pocket ligand 3,4-dichlorophenylethylamine (DPA) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9i0v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DasR in complex with a synthetic DasR-binding RNA aptamer | | Authors: | Muller, Y.A., Suess, B. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mux | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9muw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9mui | | Status: | HPUB -- hold until publication | | Title: | C. difficile RBD1 with Ca2+ | | Authors: | Hunter, D., Pozharski, E. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9mun | | Status: | HPUB -- hold until publication | | Title: | Structure of Human SLC33A1 in complex with oxidized glutathione | | Authors: | Gad, M., Hite, R.K. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9muy | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Frey, N.C., Alberstein, R.G., Seeger, F., Watkins, A.M., Gligorijevic, V., Dou, Y., Tang, Y., Regev, A., Bonneau, R. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i06 | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A8B8 glyceraldehyde-3-phosphate dehydrogenase (minor conformer) from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F. | | Deposition date: | 2025-01-14 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9hzn | | Status: | HPUB -- hold until publication | | Title: | 250 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzo | | Status: | HPUB -- hold until publication | | Title: | 270 A C1 SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
