| PDBID: | 8s7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Pseudomonas aeruginosa Recombinase A (RecA) in complex with LexAS125A mutant | | Authors: | De Felice, S., Vascon, F., Huber, S.T., Catalano, C., Jakobi, A.J., Cendron, L. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9ave | | Status: | HPUB -- hold until publication | | Title: | Mitochondrial fission 1 protein Fis1 T34E mutation | | Authors: | Mathews, I.I., Pokhrel, S., Wakatsuki, S. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9avc | | Status: | HPUB -- hold until publication | | Title: | Fis1 Structure Y38E mutation | | Authors: | Mathews, I.I., Pokhrel, S., Wakatsuki, S. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9avf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9av9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9av4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9aux | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9av3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9av0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9auv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9auy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9av1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli GuaB dCBS with inhibitor GNE9123 | | Authors: | Harris, S.F., Wu, P. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9auw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9auz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9av2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9av5 | | Status: | HPUB -- hold until publication | | Title: | Design and application of synthetic 17B-HSD13 substrates to drug discovery, and to reveal preserved catalytic activity of protective human variants | | Authors: | Liu, S., Garnsey, M. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9av8 | | Status: | HPUB -- hold until publication | | Title: | Design and application of synthetic 17B-HSD13 substrates to drug discovery, and to reveal preserved catalytic activity of protective human variants | | Authors: | Liu, S., Garnsey, M. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9avb | | Status: | HPUB -- hold until publication | | Title: | Fis1 Wild type | | Authors: | Mathes, I.I., Pokhrel, S., Wakatsuki, S. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9avd | | Status: | HPUB -- hold until publication | | Title: | Mitochondrial fission 1 protein Fis1 structure T34D mutation | | Authors: | Mathews, I.I., Pokhrel, S., Wakatsuki, S. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8yic | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-29 | | Release date: | 2025-02-28 |
|
| PDBID: | 8yig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yid | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase from Burkholderia ubonensis in complex with NADH and 6-methyl-2,3,4,5-tetrahydropyridine | | Authors: | Ma, Z.F., Shen, X.Y. | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 8yik | | Status: | HPUB -- hold until publication | | Title: | pP1192R-ATPase-domain | | Authors: | Sun, J.Q., Liu, R.L. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yi8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
