PDBID: | 9iza | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 | Release date: | 2025-08-01 |
|
PDBID: | 9izd | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 | Release date: | 2025-08-01 |
|
PDBID: | 9iz9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | VLP structure of Chikungunya virus complexed with C37 Fab, 2f block. | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | Deposition date: | 2024-08-01 |
|
PDBID: | 9izj | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izt | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izl | Status: | HPUB -- hold until publication | Title: | hVanin-1 complexed with X17 | Authors: | Fan, S., Zhen, L., Xie, T. | Deposition date: | 2024-08-01 |
|
PDBID: | 9izk | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 | Sequence: | >Entity 1 GSTVSAEDKAAAERSKEIDKCLSREKTYVKRLVKILLLGADNSGKSTFLKQMRIIHGGSGGSGGTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVDSSDFNRLTESLNDFETIVNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENARLIFRDVKDTILHDNLKQLMLQ
>Entity 2 DVQLVESGGGLVQPGGSRKLSCSASGFAFSSFGMHWVRQAPEKGLEWVAYISSGSGTIYYADTVKGRFTISRDDPKNTLFLQMTSLRSEDTAMYYCVRSIYYYGSSPFDFWGQGTTLTVSSGGGGSGGGGSGGGGSDIVMTQATSSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLTISRLEAEDVGVYYCMQHLEYPLTFGAGTKLELK
>Entity 3 MHHHHHHHHENLYFQGSSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWNGGSGGGGSGGSSSGGVSGWRLFKKIS
>Entity 4 SNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
>Entity 5 MKTIIALSYIFCLVFADYKDDDDGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLGGSGGGGSGGSSSGGVFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVIIPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINS
|
|
PDBID: | 9izi | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 9izs | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 9izz | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9j00 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9j01 | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izy | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izr | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 9izm | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izp | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 7hc4 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3367 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-08-01 |
|
PDBID: | 7hc5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3765 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-08-01 |
|
PDBID: | 7hc6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3764 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-08-01 |
|
PDBID: | 7hc7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-4051 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-08-01 |
|
PDBID: | 7hc8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3763 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-08-01 |
|
PDBID: | 7hc9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3762 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-08-01 |
|
PDBID: | 7hca | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-4636 | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-08-01 |
|
PDBID: | 9cy9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Biofilm regulatory protein A from Streptococcus mutans | Authors: | Hua, Z., Hui, W. | Deposition date: | 2024-08-01 | Release date: | 2025-08-01 |
|