| PDBID: | 8yqd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human transthyretin variant A97S in complex with Tafamidis | | Authors: | Tzeng, S.R., Huang, C.H., Wang, Y.S., Hsieh, M.F. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq3 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqm | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqa | | Status: | HPUB -- hold until publication | | Title: | Galectin-10 L27A | | Authors: | Su, J.Y., Sun, Y.Q. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqb | | Status: | HPUB -- hold until publication | | Title: | Galectin-10 N32A | | Authors: | Su, J.Y., Sun, Y.Q. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqc | | Status: | HPUB -- hold until publication | | Title: | Galectin-10 C29AC57A | | Authors: | Su, J.Y., Sun, Y.Q. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b2z | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-18 | | Release date: | 2025-03-18 |
|
| PDBID: | 9b30 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b3c | | Status: | HPUB -- hold until publication | | Title: | type 2 KD-mxyl filament of miniature tau macrocycle derived from 4R tauopathic fold | | Authors: | Xu, X., Angera, J.I., Rajewski, H.B., Jiang, W., Del Valle, R.J. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep7 | | Status: | HPUB -- hold until publication | | Title: | Poecitoxin-1a from Poecilotheria subfusca spider, a new potent peptide blocker of the human Cav1.2 channel subtype | | Authors: | Kurz, M. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epf | | Status: | HPUB -- hold until publication | | Title: | Human Picobirnavirus CP VLP | | Authors: | Rodriguez-Espinosa, M.J., Novoa, G., Martinez-Romero, J.M., de Pablo, P.J., Caston, J.R. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epd | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 8 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epg | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epi | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
