| PDBID: | 9h6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6j | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 Apo Structure | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9h6o | | Status: | HPUB -- hold until publication | | Title: | Leishmania major ISP2 in complex with bovine alpha-chymotrypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6l | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 in Complex with UDP | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9h6k | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 in Complex with UDP-GalNac | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9e4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e43 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and Phosphonoacetate | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e4b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e4c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e4d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e4e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e44 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 2-Phosphonopropionic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e45 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 1-Hydroxypropylphosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e46 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and (1-Hydroxy-2-methylpropyl)phosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e47 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and (1-Hydroxypropan-2-yl)phosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e48 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and Fosfomycin | | Authors: | Wiltsie, V., Thompson, M.K. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e3v | | Status: | HPUB -- hold until publication | | Title: | Backbone Modification in the Fungal Defensin Plectasin: Prototype NZ2114 | | Authors: | Harmon, T.W., Song, J., Gulewicz, A.J., Di, Y.P., Horne, W.S. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e3w | | Status: | HPUB -- hold until publication | | Title: | Backbone Modification in the Fungal Defensin Plectasin: beta3-Residues in the helix | | Authors: | Harmon, T.W., Song, J., Gulewicz, A.J., Di, Y.P., Horne, W.S. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e3x | | Status: | HPUB -- hold until publication | | Title: | Backbone Modification in the Fungal Defensin Plectasin: Calpha-methyl-residues in the helix | | Authors: | Harmon, T.W., Song, J., Gulewicz, A.J., Di, Y.P., Horne, W.S. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e3y | | Status: | HPUB -- hold until publication | | Title: | Backbone Modification in the Fungal Defensin Plectasin: D- and Calpha-methyl-residues in the turns | | Authors: | Harmon, T.W., Song, J., Gulewicz, A.J., Di, Y.P., Horne, W.S. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e3z | | Status: | HPUB -- hold until publication | | Title: | Backbone Modification in the Fungal Defensin Plectasin: Calpha-methyl-residues in the helix, D- and Calpha-methyl-residues in the turns | | Authors: | Harmon, T.W., Song, J., Gulewicz, A.J., Di, Y.P., Horne, W.S. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e3u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of DNMT 3A2/3B3 tetramer bound to a di-nucleosome with a 25 base-pair linker | | Authors: | Xie, X., Zhou, X.E., Worden, E., Jones, P. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e3t | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | RTA-RUNT-165 complex | | Authors: | Rudolph, M.J., Tumer, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
