| PDBID: | 8rbp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-04 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v7p | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of the truncated P1 pilin from Pseudomonas aeruginosa | | Authors: | Bragagnolo, N.J., Audette, G.F. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v7y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v6x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 2 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v6y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 3 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v6z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 4 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v70 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 6 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v71 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 7 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v72 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 8 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v73 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 9 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v74 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 10 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v75 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 11 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v76 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 12 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v77 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 13 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v78 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 14 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v79 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 15 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xad | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 8xaf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 8xag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S-BQ.1 in complex with ACE2 | | Authors: | Hsu, H.F., Wu, M.H., Chang, Y.C., Hsu, S.T.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xah | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
