PDBID: | 8u59 | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-12 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8u54 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u56 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8u58 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5c | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5n | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5q | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of human IDO1 bound to Compound 23 | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5o | Status: | HPUB -- hold until publication | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | Deposition date: | 2023-09-12 |
|
PDBID: | 8wci | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8wcf | Status: | HPUB -- hold until publication | Title: | Crystal structure of EcThsB | Authors: | Chen, Q., Yu, Y. | Deposition date: | 2023-09-12 |
|
PDBID: | 8wcg | Status: | HPUB -- hold until publication | Title: | Crystal structure of SARS-CoV-1 RBD in complex with nanobody aSR29 and aSR347 | Authors: | Zeng, W.H., Ma, H., Jin, T.C. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qhy | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qi0 | Status: | HPUB -- hold until publication | Title: | 340A Vipp1 H1-6 helical tubes | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2023-09-11 |
|
PDBID: | 8qi1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qi2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qi3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qi4 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-11 |
|
PDBID: | 8qi5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qhv | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qhw | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qhx | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qhz | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8qi6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-11 |
|
PDBID: | 8u4y | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F Mutant | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | Deposition date: | 2023-09-11 |
|