| PDBID: | 8ypm | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypn | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypo | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypl | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric phosphomimetic mutant of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypp | | Status: | HPUB -- hold until publication | | Title: | Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypq | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypg | | Status: | HPUB -- hold until publication | | Title: | NleA oligomer in the bent form | | Authors: | Machida, S., Sivaraman, J. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-17 | | Release date: | 2025-03-17 |
|
| PDBID: | 9b2v | | Status: | HPUB -- hold until publication | | Title: | SARS CoV-2 Spike protein Ectodomain with internal tag, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Kynurenine monooxygenase from Pseudomonas fluorescens complexed with 4-chlorophenylacetyltetrazole | | Authors: | Phillips, R.S., Ma, W. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9eoz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9ep3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9ep0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9ep2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-03-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8ype | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of inactive p38 complexed with a ATF2 from 46 to 80 | | Authors: | Zhang, Y.Y., Pei, C.J., He, Q.Q., Luo, Z.P., Wu, J.W., Wang, Z.X. | | Deposition date: | 2024-03-16 | | Release date: | 2025-03-16 |
|
| PDBID: | 8ypf | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of inactive p38 complexed with a ATF2 from 46 to 90 | | Authors: | Zhang, Y.Y., Pei, C.J., He, Q.Q., Luo, Z.P., Wu, J.W., Wang, Z.X. | | Deposition date: | 2024-03-16 | | Release date: | 2025-03-16 |
|
| PDBID: | 8ypa | | Status: | HPUB -- hold until publication | | Title: | Human mitochondrial ClpP in complex with TR89 | | Authors: | Li, Q.-N., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in phosphorylated state | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the LH1 complex from Allochromatium tepidum | | Authors: | Wang, G.-L., Sun, S., Yu, L.-J. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
