| PDBID: | 9bgl | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of the aminotransferase from Vibrio vulnificus responsible for the biosynthesis of 2,3-diacetamido-4-amino-2,3,4-trideoxy-arabinose in the presence of its internal aldimine | | Authors: | Fait, D.J., Thoden, J.B., Holden, H.M. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of the aminotransferase from Vibrio vulnificus responsible for the biosynthesis of 2,3-diacetamido-4-amino-2,3,4-trideoxy-arabinose in the presence of its external aldimine with 2,3-diacetamido-4-amino-2,3,4-trideoxy-l-arabinose | | Authors: | Fait, D.J., Thoden, J.B., Holden, H.M. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bhe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bhd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PRMT1-Octamer | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 14 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based inhibitor 30 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 35 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 46 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 45 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 9f1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1h | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z73 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of AF9 in complex with H3K9la peptide | | Authors: | Li, H.T., Ma, H.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6r | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 3 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6s | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 2 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z6e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
