PDBID: | 8vho | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhu | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhr | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vht | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA3 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhx | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of neck of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-02 | Release date: | 2025-01-02 |
|
PDBID: | 8vhw | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Peroxide-Soaked Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-02 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vhz | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA1 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vi0 | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA6 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhy | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Reduced Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-02 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vhv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8xod | Status: | HOLD -- hold until a certain date | Title: | ThDP-dependent HKA synthase | Authors: | Yu, J.H., Liu, T. | Deposition date: | 2024-01-01 | Release date: | 2025-01-01 |
|
PDBID: | 8xoe | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-01 |
|
PDBID: | 8xok | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-01 |
|
PDBID: | 8xol | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-01 |
|
PDBID: | 8xom | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human ABCC4 in complex with ANP-bound in NBD1 and METHOTREXATE | Authors: | Zhang, P.F., Liu, Z. | Deposition date: | 2024-01-01 |
|
PDBID: | 8rky | Status: | HPUB -- hold until publication | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-14-14 compound of the pyrrolobenzodiazepines class | Authors: | Di Palma, M., Surani, Y.M., Rahman, K.M., Steiner, R.A. | Deposition date: | 2024-01-01 |
|
PDBID: | 8vhf | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-01 |
|
PDBID: | 8vhg | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-01 |
|
PDBID: | 8xoc | Status: | HPUB -- hold until publication | Title: | beta-1,4-galacosyltransferase | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | Deposition date: | 2023-12-31 |
|
PDBID: | 8xo2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-31 |
|
PDBID: | 8xo3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-31 |
|
PDBID: | 8xo1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-31 |
|
PDBID: | 8xo4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-31 |
|