| PDBID: | 9buo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9buk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9buj | | Status: | HPUB -- hold until publication | | Title: | Structure of PfPL1 from Pseudoalteromonas fuliginea | | Authors: | Boraston, A.B., Hobbs, J.K. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9bu5 | | Status: | HPUB -- hold until publication | | Title: | CC ProXp-ala apo solution structure | | Authors: | Duran, A.D., Foster, M.P. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd8 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-chloro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd9 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-nitro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcz | | Status: | HPUB -- hold until publication | | Title: | Coxsackievirus A9 bound with compound 17 (CL301) | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of full length tetramer CysB from Klebsiella aerogenes in complex with N-acetylserine | | Authors: | Verschueren, K.H.G., Dodson, E.J., Wilkinson, A.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fde | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Pol II-TC-NER-STK19 complex | | Authors: | Lee, S.-H., Sixma, T.K. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fda | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcx | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSINHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcy | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-R21K mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALKRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fd3 | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-D190N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHNIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fdc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd7 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of Galectin-3 with an inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2024-05-16 |
|
