PDBID: | 8yxv | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyb | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yya | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Concanavalin A Complexed with 5-Fluorouracil | Authors: | Rasheed, S., Arif, R. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyg | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyh | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyi | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyj | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyk | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyf | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Hypoxanthine | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy0 | Status: | HPUB -- hold until publication | Title: | Vo domain of V/A-ATPase from Thermus thermophilus state2 | Authors: | Kishikawa, J., Nishida, Y., Nakano, A., Yokoyama, K. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yye | Status: | HPUB -- hold until publication | Title: | Crystal structure of lipase CTL (Caldibacillus Thermoamylovorans) | Authors: | Pan, S.Y., Lan, D.M., Wang, Y.H. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yyd | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy3 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-03 | Release date: | 2025-04-03 |
|
PDBID: | 8yyc | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9v | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9bad | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9p | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 | Sequence: | >Entity 1 MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
PDBID: | 9b9y | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9z | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba4 | Status: | HOLD -- hold until a certain date | Title: | full-length cross-linked Contactin 2 (CNTN2) | Authors: | Liu, J.L., Fan, S.F., Ren, G.R., Rudenko, G.R. | Deposition date: | 2024-04-03 | Release date: | 2025-04-03 |
|
PDBID: | 9b9q | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9x | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|