| PDBID: | 9e6m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the G200R mutant from the maize chloroplastic photosynthetic NADP(+)-dependent malic enzyme | | Authors: | Klinke, S., Schneberger, N., Boehm, J.M., Willms, S., Hagelueken, G., Geyer, M., Maurino, V., Alvarez, C.E. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Saccharomyces cerevisiae Pmt4-Ccw5 complex | | Authors: | Du, M., Yuan, Z., Li, H. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Locally Refined Cryo-EM map of 2G12 IgG BCR receptor lacking Fab region view | | Authors: | Thakur, B., Acharya, P. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e6n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kb5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kay | | Status: | HPUB -- hold until publication | | Title: | Bioengineered protein nanocarrier facilitating siRNA escape from lysosomes for targeted RNAi therapy in glioblastoma | | Authors: | Chen, X., Fan, K. | | Deposition date: | 2024-10-30 | | Sequence: | >Entity 1
TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHKERRHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNKQVKAIKKLGDHVTNLRKMG
|
|
| PDBID: | 9kbd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kb1 | | Status: | HPUB -- hold until publication | | Title: | The structure of the carbohydrate deacetylase apo PpOngB from Pseudoalteromonas prydzensis ACAM 620. | | Authors: | Wang, J.P., Li, P.Y. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kbe | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-30 | | Release date: | 2025-10-30 |
|
| PDBID: | 9kax | | Status: | HOLD -- hold until a certain date | | Title: | The outward-open structure of BjSemiSWEET in native cellular membranes determined by in situ solid-state NMR | | Authors: | Xie, H., Yang, J. | | Deposition date: | 2024-10-30 | | Release date: | 2025-10-30 |
|
| PDBID: | 9kba | | Status: | HOLD -- hold until a certain date | | Title: | The occluded structures of BjSemiSWEET in native cellular membranes determined by in situ solid-state NMR | | Authors: | Xie, H., Yang, J. | | Deposition date: | 2024-10-30 | | Release date: | 2025-10-30 |
|
| PDBID: | 9kb4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the complexes of PpOngB bound with citrate | | Authors: | Wang, J.P. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kb3 | | Status: | HPUB -- hold until publication | | Title: | The structure of the PpOngB-GlcNAc1A complex | | Authors: | Wang, J.P., Li, P.Y. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kbb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kbc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kb6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kb7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kb8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9kb9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-30 |
|
