| PDBID: | 9e44 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 2-Phosphonopropionic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e4f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8q | | Status: | HPUB -- hold until publication | | Title: | Structure of Promiscuous Short Chain reductase Spm14 | | Authors: | Jing, L.Q., Peng, M., Chen, Y.Y., Ju, J.H., Wu, D.L. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8r | | Status: | HPUB -- hold until publication | | Title: | Structure of Promiscuous short chain dehydrogenase Spm14 in complex with NADPH | | Authors: | Jing, L.Q., Peng, M., Chen, Y.Y., Ju, J.H., Wu, D.L. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed zinc-induced homotetramer C4-Zn1-HEHE-1 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8v | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the Type II secretion system protein from Vibrio cholerae | | Authors: | Liu, R.H., Feng, Q.S., Zhang, K., Dai, X., Dai, J., Guo, X.R., Lin, W.F., Wang, Z.F., Fu, Y., Li, Y. | | Deposition date: | 2024-10-24 | | Release date: | 2025-10-24 |
|
| PDBID: | 9k7u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed zinc-induced heterodimer Heter-Zn2-HEHE-22 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed nickel-induced homotrimer C3-Ni1-HH*3-18 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-14 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7z | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-16 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k82 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n5-Zn1-HEHE-917 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k83 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n6-Zn1-HEHE-43 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k84 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n6-Zn1-HEHE-44 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k85 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n6-Zn1-HEHE-46 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8u | | Status: | HPUB -- hold until publication | | Title: | Ethanol dehydrogenase of Bursaphelenchus xylophilus | | Authors: | Xing, Z.F., Luo, X., Li, X.Y., Song, R.J., Song, B.A. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k86 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n6-Zn1-HEHE-410 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k87 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-5 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k89 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-6 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed calcium-induced homotrimer C3-Ca1-DN*3-20 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8a | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of monomer of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-24 | | Release date: | 2025-10-24 |
|
| PDBID: | 9k8c | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C2 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
MGHHHHHHHHSSGLEVLFQGPGGTMEKLKEIVKHLEVAIKYLKEGKVDLADLVVADAIELAKEAGDKASLEILKVAHKAIDTLGREGKLEEAAKIVKYAKEYVEAKIKGDREKLRELLEKVKKDVLEAIKKGDEEFYEALVKIARIIAEDLGDEKSLKVLEALEEFFKEWKRLEKEGKSLDEKLHLFLRVGERLLEIGDKESLEMLIELLEELAKEIKKAGNEELLVRAEAAIKDIRKHIKEL
|
|
