| PDBID: | 9jvw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Overall structure of human EAAT2 bound with inhibitor (WAY-213613) | | Authors: | Xia, L.Y., Zhang, Y.Y., Shi, Y., Huang, J., Zhou, Q. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Overall structure of human EAAT2 bound with activator (GT949) | | Authors: | Xia, L.Y., Zhang, Y.Y., Shi, Y., Huang, J., Zhou, Q. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jw0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jw5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of OsSPS3 complexed with YH24786 | | Authors: | Xiao, H., Li, M., Yang, G.-F. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of hemagglutinin H5 A/Texas/37/2024 in complex with LSTa and antibody CR9114 | | Authors: | Fernandez-Quintero, M.L., Han, J., Rodriguez, A.J., Ward, A.B. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of FABLE, MPD condition | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of FABLE, PEG 400 condition | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of FABLE, PEG 600 condition | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwo | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C4-Dicarboxylate-Binding Protein (PA0884) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with L-Malate | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-10-09 | | Sequence: | >Entity 1
SNAAQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9dwq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PKD2 ion channel, F629S variant | | Authors: | Esarte Palomero, O., DeCaen, P.G. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C4-Dicarboxylate-Binding Protein (PA0884) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with Mesaconic Acid | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-10-09 | | Sequence: | >Entity 1
SNAAQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9h0f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | SARS-CoV-2 Mpro in complex with a silicon-containing inhibitor | | Authors: | Andrews-Clark, T.C., Laczi, D., Schoenbauer, S., Brewitz, L., Schofield, C.J., Walsh, M. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fucosylated Lacto-N-biose binding protein from Bifidobacterium longum subsp. infantis in complex with Lacto-N-biose | | Authors: | Jensen, M., Hansen, M.E., Sakanaka, H., Slotboom, D.J., Abou Hachem, M., Morth, J.P. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fucosylated Lacto-N-biose binding protein from Bifidobacterium longum subsp. infantis in complex with Galacto-N-biose | | Authors: | Jensen, M., Hansen, M.E., Sakanaka, H., Slotboom, D.J., Abou Hachem, M., Morth, J.P. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of BiP ATPase domain in complex with CDNF C-terminal domain at 1.65 angstroms resolution | | Authors: | Fudo, S., Shpironok, O., Saarma, M., Kajander, T. | | Deposition date: | 2024-10-08 |
|
