| PDBID: | 8xzp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xza | | Status: | HPUB -- hold until publication | | Title: | BA.2.86 Spike in complex with bovine ACE2 (Local refinement) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 2 ACE2) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8y00 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8rqy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MakC from the mak operon of Vibrio cholerae | | Authors: | Bodra, N., Persson, K. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8vrc | | Status: | HPUB -- hold until publication | | Title: | Tetrahymena thermophila MLP1 RRM domain | | Authors: | Donaldson, L.W. | | Deposition date: | 2024-01-21 | | Sequence: | >Entity 1
TFQPIIFSTACEQEGVANWRNITEALLKQHNVHAPYCRFGKLEGNFALNKDKTSQEVIDQLVQDGLQFGESKVTIKVSEGEALSKFWELHGRHYNGVMEL
|
|
| PDBID: | 8vrf | | Status: | HPUB -- hold until publication | | Title: | Sucrose-phosphate synthase-like protein from Leishmania major | | Authors: | Gorman, M.A., Parker, M.W., McConville, M.J. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8vr9 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8vr4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyv | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein 0705-5 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyr | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein GPX4-2 | | Authors: | Liu, L.J., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xys | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein GPX4-1 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyt | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein GPX4-4 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyu | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein GPX4-3 | | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyw | | Status: | HPUB -- hold until publication | | Title: | De novo designed protein Trx-3 | | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xyn | | Status: | HPUB -- hold until publication | | Title: | Structure of the engineered retro-aldolase RA95.5-8 | | Authors: | Kunthic, T., Yu, M.Z., Xiang, Z. | | Deposition date: | 2024-01-20 |
|
