| PDBID: | 9gvz | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1j conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gw0 | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1l conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gw3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw6 | | Status: | HPUB -- hold until publication | | Title: | Lys9DabMC6*a 2-Delta | | Authors: | Maglio, O., Lombardi, A., Chino, M., Pirro, F. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of alpha-carboxysome T=4 mini-shell containing CTD only mutant of CsoSCA | | Authors: | Ng, P.C., Basle, A., Marles-Wright, J., Liu, L. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw5 | | Status: | HPUB -- hold until publication | | Title: | type-I interferon autoantibodies pmab3, pmab19 and pmab14 in complex with Interferon alpha-2 | | Authors: | Duquerroy, S., Rey, F., Mahevas, M., Chappert, P., Ahouzi, O. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9dry | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
