PDBID: | 9bcf | Status: | HPUB -- hold until publication | Title: | Chimeric protein of crocodile allergen Cro p 1.0101 and GFP | Authors: | O''Malley, A., Ruethers, T., Lopata, A.L., Chruszcz, M. | Deposition date: | 2024-04-09 |
|
PDBID: | 9bch | Status: | HPUB -- hold until publication | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | Authors: | Mahoney, B.J., Clubb, R.T. | Deposition date: | 2024-04-09 | Sequence: | >Entity 1 SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
PDBID: | 9bcg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Myeloid cell leukemia-1 (Mcl-1) complexed with compound | Authors: | Zhao, B., Fesik, S.W. | Deposition date: | 2024-04-09 |
|
PDBID: | 9bcl | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bck | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bcm | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bcr | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-09 | Release date: | 2025-04-09 |
|
PDBID: | 9bcn | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bcu | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bco | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bcp | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bcq | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bcs | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9bcv | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9exs | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-08 | Release date: | 2025-04-08 |
|
PDBID: | 9exi | Status: | HPUB -- hold until publication | Title: | Coxsackievirus A9 bound with compound 14 (CL275) | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | Deposition date: | 2024-04-08 |
|
PDBID: | 9exe | Status: | HOLD -- hold until a certain date | Title: | membrane complex from Haemophilus influenzae - conformation A | Authors: | Castro, D.K.D.V., Delepelaire, P., Biou, V. | Deposition date: | 2024-04-08 | Release date: | 2025-04-08 |
|
PDBID: | 9exm | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-08 |
|
PDBID: | 9exh | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the Apo E. coli BrxX methyltransferase | Authors: | Adams, M.C., Ghilarov, D. | Deposition date: | 2024-04-08 |
|
PDBID: | 9exj | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-08 |
|
PDBID: | 9exl | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-08 |
|
PDBID: | 9exp | Status: | HOLD -- hold until a certain date | Title: | Wzc-K540M-2YE MgADP C8 | Authors: | Liu, J.W., Yang, Y., Naismith, J.H. | Deposition date: | 2024-04-08 | Release date: | 2025-04-08 |
|
PDBID: | 9exq | Status: | HOLD -- hold until a certain date | Title: | Wzc-K540M-3YE-N711Y MgADP C1 | Authors: | Liu, J.W., Yang, Y., Naismith, J.H. | Deposition date: | 2024-04-08 | Release date: | 2025-04-08 |
|
PDBID: | 9exg | Status: | HPUB -- hold until publication | Title: | Crystal structure of Yeast Clathrin Heavy Chain N-terminal domain bound to Epsin-2 peptide (LIDL) | Authors: | Defelipe, L.A., Bento, I., Garcia Alai, M.M. | Deposition date: | 2024-04-08 |
|
PDBID: | 9exr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Wzc-K540M-3YE-N711Y MgADP C8 | Authors: | Liu, J.W., Yang, Y., Naismith, J.H. | Deposition date: | 2024-04-08 | Release date: | 2025-04-08 |
|