PDBID: | 8wrs | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Cas12-1 with 5 nt complementary heteroduplex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8wrr | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Cas12-1 with 10 nt complementary heteroduplex | Authors: | Zhang, X., Zhang, K. | Deposition date: | 2023-10-16 |
|
PDBID: | 8ws7 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-1 with 10 nt complementary heteroduplex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8wrt | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Cas12-1/crRNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8ws6 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-1 with 14 nt complementary heteroduplex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8ws5 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Cas12-1-N2/crRNA/Target DNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8wrw | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-1-N1/crRNA/Target DNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8wrp | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Cas12-1 with 20 nt complementary heteroduplex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 |
|
PDBID: | 8wri | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of FrCas9 in complex with sgRNA and 26-nt TS and 4-nt NTS substrates | Authors: | Chen, S.D., Yang, M., Liu, S.Q. | Deposition date: | 2023-10-15 |
|
PDBID: | 8wrn | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-10-15 | Release date: | 2024-10-15 |
|
PDBID: | 8ukp | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-14 |
|
PDBID: | 8uko | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-14 |
|
PDBID: | 8ukn | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-14 |
|
PDBID: | 8wrg | Status: | HPUB -- hold until publication | Title: | Solution structure of the TAD domain (450-504) of human transcriptional coactivator YAP1 | Authors: | Zhang, H., Li, Y. | Deposition date: | 2023-10-14 |
|
PDBID: | 8wrf | Status: | HPUB -- hold until publication | Title: | Crystal structure of MexL | Authors: | Wei, Y., Wu, Z.K. | Deposition date: | 2023-10-14 | Sequence: | >Entity 1 GSHMDPAKREAILEAAKRLFLCNGYDGSSMEAIASEAGVSKLTVYSHFTDKETLFSEAVKAKCAEQLPALYFQLAEGAPLEKVLLNIARGFHRLINSHEAIALTRLMAAQAGQNPKLSELFFEAGPKQVIDEMERLLEQARRSGKLAFPDARHAAEHFFMLVKGCANYRLLIGCAEPLDEAEGERHVEEVVALFLRAFAAGG
|
|
PDBID: | 8qtx | Status: | HPUB -- hold until publication | Title: | Structure of human butyrylcholinesterase with 3-(((2-cycloheptylethyl)(methyl)amino)methyl)-N-methyl-1H-indol-7-amine | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qtw | Status: | HPUB -- hold until publication | Title: | Structure of human butyrylcholinesterase with (3-(((2-cycloheptylethyl)(methyl)amino)methyl)-1H-indol-7-yl)(methyl)carbamoylated Ser198 | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qty | Status: | HPUB -- hold until publication | Title: | LytR LCP domain from Streptococcus dysgalactiae subs. dysgalactiae | Authors: | Paquete-Ferreira, J., Romao, M.J., Santos-Silva, T. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qtv | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-13 |
|
PDBID: | 8qtr | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of the FB-bound yeast Ceramide Synthase | Authors: | Schaefer, J., Clausmeyer, L., Koerner, C., Moeller, A., Froehlich, F. | Deposition date: | 2023-10-13 | Release date: | 2024-10-13 |
|
PDBID: | 8qtu | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-3 and NAD+ | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qtz | Status: | HPUB -- hold until publication | Title: | Cryo-EM reconstruction of VP5*/VP8* assembly from SA11 Rotavirus Tripsinized Triple Layered Particle | Authors: | Asensio-Cob, D., Perez-Mata, C., Gomez-Blanco, J., Vargas, J., Rodriguez, J.M., Luque, D. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qu0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-13 |
|
PDBID: | 8qu6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-13 |
|
PDBID: | 8uki | Status: | HPUB -- hold until publication | Title: | Crystal structure of 04_A06 Fab | Authors: | DeLaitsch, A.T., Gristick, H.B., Bjorkman, P.J. | Deposition date: | 2023-10-13 |
|