PDBID: | 8zbr | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-27 |
|
PDBID: | 9bkd | Status: | AUTH -- processed, waiting for author review and approval | Title: | The structure of human Pdcd4 bound to the 40S small ribosomal subunit | Authors: | Brito Querido, J., Sokabe, M., Diaz-Lopez, I., Gordiyenko, Y., Zuber, P., Albacete-Albacete, L., Ramakrishnan, V., S.Fraser, C. | Deposition date: | 2024-04-27 |
|
PDBID: | 9bkc | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Rid family protein PFL1385 from Pseudomonas fluorescens | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | Deposition date: | 2024-04-27 |
|
PDBID: | 9bke | Status: | AUTH -- processed, waiting for author review and approval | Title: | STRUCTURE OF 4-HYDROXYPHENYLACETATE 3-MONOOXYGENASE (HPAB), OXYGENASE COMPONENT FROM ESCHERICHIA COLI MUTANT XS6 WITH AMP BOUND | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | Deposition date: | 2024-04-27 |
|
PDBID: | 9f4b | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-26 |
|
PDBID: | 9f4a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f3v | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f46 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f3u | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f47 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f49 | Status: | HOLD -- hold until a certain date | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | Authors: | Pichel, A., van Raaij, M.J. | Deposition date: | 2024-04-26 | Release date: | 2024-06-21 | Sequence: | >Entity 1 KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
PDBID: | 8zb6 | Status: | HPUB -- hold until publication | Title: | Yeast-expressed polio type 2 stabilized virus-like particles | Authors: | Hong, Q., Cong, Y. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zb3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NudC from Mycobacterium abscessus | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zb4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NudC from Mycobacterium abscessus in complex with NAD | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zb5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NudC from Mycobacterium abscessus in complex with AMP | Authors: | Meng, L., Zhang, Y., Xu, J., Liu, J. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zbf | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8zb9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8zba | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8zbb | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of outward state Anhydromuropeptide permease (AmpG) G50W/L269W | Authors: | Yoo, Y., Chang, N., Kim, U., Kim, H., Cho, H. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zbi | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8zbd | Status: | HPUB -- hold until publication | Title: | Crystal structure of Persulfide Dioxygenase from Beggiatoa leptomitoformis | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Rudenko, T.S. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zb2 | Status: | HPUB -- hold until publication | Title: | L-Methionine oxidase from Burkholderiales bacterium | Authors: | Kawamura, Y., Chisuga, T., Nakano, S. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zbl | Status: | HPUB -- hold until publication | Title: | Glycosidated glycyrrhetinic acid derivative as a soluble epoxide hydrolase inhibitor | Authors: | Wang, H., Feng, Y., Ge, Z.H. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zb7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human left ventricle ATM complex | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | Deposition date: | 2024-04-26 |
|
PDBID: | 8zbm | Status: | HPUB -- hold until publication | Title: | RAT skeletal muscle ATM complex | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | Deposition date: | 2024-04-26 |
|