PDBID: | 8s1n | Status: | HPUB -- hold until publication | Title: | Structure of GDP form of Rac1 | Authors: | Ferrandez, Y., Nawrotek, A., Cherfils, J. | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s13 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s14 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s15 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s17 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s16 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s18 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s19 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s1a | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s1b | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s1d | Status: | HPUB -- hold until publication | Title: | Crystal structure of the influenza A matrix protein 1 peptide 100-114 in complex with HLA-DRB1*04:04 | Authors: | Sharma, R.K., Dubnovitsky, A., Gerstner, C., Boddul, S., James, T., Turcinov, S., Horuluoglu, B., Andriopoulos, P., Kozhukh, G., Achour, A., Wermeling, F., Kwok, W.W., Ronnblom, L., Klareskog, L., James, E., Padyukov, L., Malmstrom, V. | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s1e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s1f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s1l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8rvv | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-15 | Release date: | 2025-08-15 |
|
PDBID: | 8s0g | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-14 | Release date: | 2025-08-14 |
|
PDBID: | 8ybi | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-14 | Release date: | 2025-08-14 |
|
PDBID: | 8s05 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | ArnAB complex an archaeal ortholog of the Sec23/24 core motif | Authors: | Korf, L., Steinchen, W., Watad, M., Bezold, F., Vogt, M.S., Selbach, L., Penner, A., Tourte, M., Hepp, S., Albers, S.V., Essen, L.-O. | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 | Release date: | 2025-08-13 | Sequence: | >Entity 1 MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAF(CRO)NRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP
>Entity 2 MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ
|
|
PDBID: | 8vzw | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of humanized MS-Hu6 Fab fragment | Authors: | Misra, A., Schuermann, J., Gupta, Y.K., Mone, Z. | Deposition date: | 2024-02-12 |
|
PDBID: | 8vzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 | Release date: | 2025-08-11 |
|
PDBID: | 8vzu | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 | Release date: | 2025-08-11 |
|
PDBID: | 8vzt | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 | Release date: | 2025-08-11 |
|
PDBID: | 8yba | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 | Release date: | 2025-08-12 |
|
PDBID: | 8yb9 | Status: | HPUB -- hold until publication | Title: | Yeast NPC pre-60S assembly intermediate (state C13) | Authors: | Chen, S.J.B., Sui, S.F. | Deposition date: | 2024-02-12 | Release date: | 2025-08-12 |
|