| PDBID: | 9h0q | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin in complex with N-(beta-L-Fucopyranosyl)-biphenyl-3-carboxamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-10-08 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9h0e | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CREBBP histone acetyltransferase domain in complex with Propionyl- Coenzyme A | | Authors: | Mechaly, A.E., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0h | | Status: | HPUB -- hold until publication | | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1-OPABACTIN-HAB1 TERNARY COMPLEX | | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0i | | Status: | HPUB -- hold until publication | | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1-iCB-HAB1 TERNARY COMPLEX | | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0j | | Status: | HPUB -- hold until publication | | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1 5M (V112L, T135L, F137I, T153I, V168A)-iCB-HAB1 TERNARY COMPLEX | | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jv7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | De novo designed protein GFP-19 | | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jv0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P450BytO from Planomonospora sp. | | Authors: | Wang, H.Q., Xiang, Z. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9juj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9juk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jul | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jum | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jun | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9juo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jup | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9juv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jux | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 | | Release date: | 2025-10-08 |
|
| PDBID: | 9jus | | Status: | HPUB -- hold until publication | | Title: | Structure of villin bound to an actin trimer | | Authors: | Robinson, R.C. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
