| PDBID: | 9f1l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 35 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 46 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 9f1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 45 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1h | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f1i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z73 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of AF9 in complex with H3K9la peptide | | Authors: | Li, H.T., Ma, H.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z70 | | Status: | HPUB -- hold until publication | | Title: | State 1 (S1) of yeast 80S ribosome bound to 2 tRNAs during mRNA decoding | | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6t | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 RBD in complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6x | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 RBD in complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6r | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 3 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6s | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 2 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z6e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z6w | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 S trimer with 3 down-RBDs complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6z | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH-WT | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6y | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH mutant-V164K&V221A&H333K | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 XBB.1.16 Spike in complex with CYFN1006-1(S-CYFN1006-1 dimer trimer). | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
