PDBID: | 8zho | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 S1 in complex with H18 and R1-32 Fab | Authors: | Yan, Q., Gao, X., Liu, B., Hou, R., He, P., Li, Z., Chen, Q., Wang, J., He, J., Chen, L., Zhao, J., Xiong, X. | Deposition date: | 2024-05-11 |
|
PDBID: | 8zhp | Status: | AUTH -- processed, waiting for author review and approval | Title: | Dimer of SARS-CoV-2 S1 in complex with H18 and R1-32 Fabs | Authors: | Yan, Q., Gao, X., Liu, B., Hou, R., He, P., Li, Z., Chen, Q., Wang, J., He, J., Chen, L., Zhao, J., Xiong, X. | Deposition date: | 2024-05-11 |
|
PDBID: | 8zht | Status: | HPUB -- hold until publication | Title: | Structure of PpiD-YfgM complex | Authors: | Xu, J.H., Chen, Z., Gao, X. | Deposition date: | 2024-05-11 |
|
PDBID: | 8zhu | Status: | HPUB -- hold until publication | Title: | Structure of 3-amino-3-carboxyltransferase in complex with 5-thioadenosine in the biosynthesis of nocardicins | Authors: | Gao, Y., Mori, T., Awakawa, T., Abe, I. | Deposition date: | 2024-05-11 |
|
PDBID: | 8zhv | Status: | HPUB -- hold until publication | Title: | Structure of 3-amino-3-carboxyltransferase in complex with SAH and nocardicin G in the biosynthesis of nocardicins | Authors: | Gao, Y., Mori, T., Awakawa, T., Abe, I. | Deposition date: | 2024-05-11 |
|
PDBID: | 8zhw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-11 |
|
PDBID: | 9bre | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL019-21 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brf | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL004-21 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brg | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL055-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brh | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL056-21 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9bri | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL064-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brl | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL080-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brm | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL077-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brn | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL050-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9bro | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL030-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brp | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL047-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brv | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 5 | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brx | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 10 | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brw | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 7 | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | Deposition date: | 2024-05-11 | Sequence: | >Entity 1 MREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQSGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPLEHHH
|
|
PDBID: | 9brj | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL093-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9brk | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL098-22 | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-05-11 |
|
PDBID: | 9fa9 | Status: | HPUB -- hold until publication | Title: | Coxsackievirus A9 bound with compound 16 (CL298) | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | Deposition date: | 2024-05-10 |
|
PDBID: | 9faj | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-10 |
|
PDBID: | 9fak | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-10 |
|
PDBID: | 9fam | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-10 |
|