| PDBID: | 9i3u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the AGR2 dimer in complex with the monomeric IRE1beta luminal domain | | Authors: | Yan, Y., Hardwick, S., Tung, J., Ron, D. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i44 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i42 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-2D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3w | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-8C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i43 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-9D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3x | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-11B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3z | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-12D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i41 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-3C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i40 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-4D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i45 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-10B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
QSALTQPASVSGSPGQSITISCTGTSSIFGSYYLVSWYQQYPGKAPKLIVYEGSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEAAYYCCSYAGTRTYVFGTGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADKSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
>Entity 2
EVQLVQSGSELKKPGASVKVSCKVSRSTFVNYAVNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLLISGLKADDSAVYYCAYDPLGNWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKHHHHHH
|
|
| PDBID: | 9i4c | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-1-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4d | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-2B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4b | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4e | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 34-1-6D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4j | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-04-161 compound of the pyrrolobenzodiazepines class | | Authors: | Di Palma, M., Steiner, R.A. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lpd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lpe | | Status: | HPUB -- hold until publication | | Title: | ATPDF2 HDZIP domain complexed with DNA | | Authors: | Chen, W., Huang, H.D. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lph | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 ligand-free form at room temperature | | Authors: | Yano, N., Fushinobu, S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lpf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lpj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE triple mutant (Ile12Phe, Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE double mutant (Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n17 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n16 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
