| PDBID: | 9qy1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Endo180 (uPARAP) carbohydrate-recognition domain 2 with bound methyl fucoside | | Authors: | Drickamer, K., Feinberg, H., Weis, W.I., Taylor, M.E., Jegouzo, S.A.F. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9uid | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uie | | Status: | HPUB -- hold until publication | | Title: | Electronic microscopy structure of human schlafen14-E211A dimer in complex with dsRNA | | Authors: | Mengyun, L., Dapeng, S., Wei, H., Yumei, W., Sheng, C. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uil | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uia | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uhy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human adenosine A2A receptor bound to the agonist adenosine resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ui6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uib | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Oryza sativa SGT1-TPR domain | | Authors: | Xin, Z. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uig | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CYP204A3 | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z., Tian, W.Y. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uic | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uij | | Status: | HPUB -- hold until publication | | Title: | FicAT in Klebsiella pneumoniae | | Authors: | Song, P. | | Deposition date: | 2025-04-15 | | Release date: | 2026-04-15 | | Sequence: | >Entity 1
MSDKFGDERDPYLYPALNVLRNRLGIRQAKNLQQAAFQMTALRAATLPLGPRVRGLPYLCAIHHQLYQDLFDWAGRLREVNLYLGDTPFCHFARIEEEGNALMQALEQEDYLSGLPRDTFIERLSWFYGEINVLHPFRLGNGLTQRIFFEQLAIHAGYLLDWRDVDPAGWSAACQQSAMGDLAPLVAIFRKVVSEARESE
>Entity 2
MGSSHHHHHHHHMRPLTDKQKSRLWEQTRNTNFQASRRLEGVTVPLVTLTAEEALARLATLRREYER
|
|
| PDBID: | 9uih | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uii | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CCR8 bound to the antagonist IPG7236 resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uik | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CCR8 in ligand free state resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uin | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9uim | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human CB1 cannabinoid receptor bound to the inverse agonist taranabant resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-15 |
|
