PDBID: | 8w8u | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w92 | Status: | HPUB -- hold until publication | Title: | human H ferritin with 2 Fe(II)/subunit loading | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w94 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 2 s | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8qf6 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-03 |
|
PDBID: | 8w8j | Status: | HPUB -- hold until publication | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-19 | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2023-09-03 |
|
PDBID: | 8w8l | Status: | HPUB -- hold until publication | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-38 | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2023-09-03 |
|
PDBID: | 8w8i | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-02 | Sequence: | >Entity 1 MKKLLIAAGSVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIALHHHHHH
>Entity 2 MKKLLIAAGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSKINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSHHHHHH
|
|
PDBID: | 8w8g | Status: | HPUB -- hold until publication | Title: | Crystal structure of human TRF1 with PinX1 | Authors: | Lei, M., Wu, J. | Deposition date: | 2023-09-02 |
|
PDBID: | 8w8h | Status: | HPUB -- hold until publication | Title: | 2-Ketoglutarate-Dependent Dioxygenase | Authors: | Zheng, C.N., Wei, W.Q. | Deposition date: | 2023-09-02 |
|
PDBID: | 8qes | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8qep | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8qeq | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8qew | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8qf0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8u1p | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-01 |
|
PDBID: | 8u1h | Status: | HPUB -- hold until publication | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | Deposition date: | 2023-09-01 |
|
PDBID: | 8qeg | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 | Release date: | 2025-03-04 |
|
PDBID: | 8p85 | Status: | AUTH -- processed, waiting for author review and approval | Title: | 80S yeast ribosome in complex with Fluorolissoclimide | Authors: | Terrosu, S., Yusupov, M. | Deposition date: | 2023-08-31 |
|
PDBID: | 8qea | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qem | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qek | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qei | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qej | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|
PDBID: | 8qeh | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 | Release date: | 2024-11-30 |
|
PDBID: | 8u1a | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-31 |
|