| PDBID: | 9lwu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9lww | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9lwz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oxidized state of thioredoxin gluthathione reductase from Schistosoma japonicum with the U597C mutation SjTGR-U597C-oxidized | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9lx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9lx2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9lwv | | Status: | HPUB -- hold until publication | | Title: | Arginine bis-prenyltransferase DciF | | Authors: | Mori, T., Taniguchi, T., Matsuda, K., Wakimoto, T., Abe, I. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncs | | Status: | HPUB -- hold until publication | | Title: | RNase A in complex with Uridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-02-17 | | Sequence: | >Entity 1
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
| PDBID: | 9nd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of WDR5 in complex with Triazole-Based Inhibitors | | Authors: | Goins, C.M., Stauffer, S.R. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncv | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of WDR5 in complex with Triazole-Based Inhibitors | | Authors: | Goins, C.M., Stauffer, S.R. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncu | | Status: | HPUB -- hold until publication | | Title: | NitrOFF1 ""OFF"" State | | Authors: | Smailys, J., Zhang, Y. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and symmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional G/C rich expansion sequence | | Authors: | Shields, E.T., Snow, C.D., Slaughter, C.K. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd7 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 75s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 for 75s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd6 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 50s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 50s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Fas-FADD complex | | Authors: | Fosuah, E., Lin, Q., Shen, Z., Fu, T.M. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncx | | Status: | HPUB -- hold until publication | | Title: | NitrOFF1 ""ON"" State | | Authors: | Smailys, J., Zhang, Y. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd8 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 95s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 95s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd9 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH11-pH9.5; 5s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 5s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nct | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9if2 | | Status: | HPUB -- hold until publication | | Title: | ZnT1 CTD regulation | | Authors: | Ben-Yosef, T.E., Zarivach, R., Shahar, A. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9if7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9if8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
