| PDBID: | 9jpz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jqg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rice DWARF14 in complex with Cyclo(L-Leu-L-Pro) | | Authors: | Wang, Q.X., Feng, Q.X., Wang, B., Bai, Y. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jql | | Status: | HOLD -- hold until a certain date | | Title: | The C-terminal structure of N6-methyladenosine deaminase | | Authors: | Xie, W., Jia, Q. | | Deposition date: | 2024-09-27 | | Release date: | 2025-09-27 |
|
| PDBID: | 9jq3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jq7 | | Status: | HPUB -- hold until publication | | Title: | Calcium-free C2 domain protein from Heimdallarchaeia | | Authors: | Chongrungreang, T., Robinson, R.C. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jqj | | Status: | HPUB -- hold until publication | | Title: | CTB10-M4-ent-1i complex | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jqk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jqh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9jqn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9gvx | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1e conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gvy | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1m conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gvz | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1j conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gw0 | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1l conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gw3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
