| PDBID: | 8u5o | | Status: | HPUB -- hold until publication | | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u59 | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-12 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8u54 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u58 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u56 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of EcThsB | | Authors: | Chen, Q., Yu, Y. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-1 RBD in complex with nanobody aSR29 and aSR347 | | Authors: | Zeng, W.H., Ma, H., Jin, T.C. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi0 | | Status: | HPUB -- hold until publication | | Title: | 340A Vipp1 H1-6 helical tubes | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u4x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pr state | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u4y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-11 |
|
