PDBID: | 8ume | Status: | AUTH -- processed, waiting for author review and approval | Title: | Influenza A virus Hemagglutinin H5/Vietnam/1204/2004 in complex with D04 Fab | Authors: | Ferreira Ramos, A.S., Bajic, G. | Deposition date: | 2023-10-17 |
|
PDBID: | 8um5 | Status: | HPUB -- hold until publication | Title: | X-ray structure of human SHIP1 Ptase-C2 domains covalently bound to TREAT-AD (TAD) compound TAD-58547 | Authors: | Mesecar, A.D., Hamdani, A.K. | Deposition date: | 2023-10-17 | Sequence: | >Entity 1 SMEQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAETIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHHGELTGHFQGEIKLQTSQ
|
|
PDBID: | 8umf | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-17 |
|
PDBID: | 8umj | Status: | HPUB -- hold until publication | Title: | Wild type EPSP synthase complexed with glyphosate and shikimate-3-phosphate | Authors: | Kim, W., Zhang, Y.J. | Deposition date: | 2023-10-17 |
|
PDBID: | 8umh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-17 |
|
PDBID: | 8um0 | Status: | HPUB -- hold until publication | Title: | The structure of NanH in complex with Neu5,7,9Ac(2,6)-LAcNAc | Authors: | Medley, B.J., Boraston, A.B. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsb | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 1 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 1 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsd | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 2 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wse | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 2 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsg | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 3 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsz | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsa | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsr | Status: | HPUB -- hold until publication | Title: | the structure of BtSY1_RBD/hACE2 protein | Authors: | Xu, Z.P., Sun, J.Q. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsv | Status: | HPUB -- hold until publication | Title: | Pre-binding structure of HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) in presence of sub optimal concentration of 4-hydroxy benzoic acid | Authors: | Goswami, A., Raju, R., Kasarla, M., Ullah, S. | Deposition date: | 2023-10-17 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 8wsf | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 3 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8ws9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM mini structure of Cas12-1 with 5 nt complementary heteroduplex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsh | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease, pH=4.0 | Authors: | Zhou, X.L., Jiang, H.H., Zhang, J., Li, J. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsi | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease, pH=6.0 | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsj | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease, pH=6.5 | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsk | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease, pH=8.5 | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wso | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wt0 | Status: | HOLD -- hold until a certain date | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|