| PDBID: | 8yqn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-19 | | Release date: | 2025-03-19 |
|
| PDBID: | 8yqo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of human lanosterol 14alpha-demethylase (CYP51) in complex with FLZ | | Authors: | Zhou, L.C. | | Deposition date: | 2024-03-19 | | Release date: | 2025-03-19 |
|
| PDBID: | 9b2z | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-18 | | Release date: | 2025-03-18 |
|
| PDBID: | 9b30 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b3c | | Status: | HPUB -- hold until publication | | Title: | type 2 KD-mxyl filament of miniature tau macrocycle derived from 4R tauopathic fold | | Authors: | Xu, X., Angera, J.I., Rajewski, H.B., Jiang, W., Del Valle, R.J. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep7 | | Status: | HPUB -- hold until publication | | Title: | Poecitoxin-1a from Poecilotheria subfusca spider, a new potent peptide blocker of the human Cav1.2 channel subtype | | Authors: | Kurz, M. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epf | | Status: | HPUB -- hold until publication | | Title: | Human Picobirnavirus CP VLP | | Authors: | Rodriguez-Espinosa, M.J., Novoa, G., Martinez-Romero, J.M., de Pablo, P.J., Caston, J.R. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epd | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 8 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epg | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epi | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yq2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ratTRPV1 bount with inhibitor AMG9810 | | Authors: | Gao, Y.H., Li, Z.X. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
