| PDBID: | 8r1x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8r1r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-02 | | Release date: | 2024-11-02 |
|
| PDBID: | 8r1q | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 Mpro (Omicron, P132H+T169S) in complex with alpha-ketoamide 13b-K | | Authors: | Sun, X., Ibrahim, M., Hilgenfeld, R. | | Deposition date: | 2023-11-02 | | Release date: | 2023-11-30 |
|
| PDBID: | 8uv6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Integrin a4b7 bound to MadCAM-1 | | Authors: | Hollis, J.A., Campbell, M.G., Malik, H.S. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uv5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Integrin aEb7 in the compact conformation | | Authors: | Hollis, J.A., Campbell, M.G., Malik, H.S. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uvd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uvf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uvg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uv1 | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 complexed with compound IB01 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke, T.R. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uv2 | | Status: | HPUB -- hold until publication | | Title: | Human p97/VCP structure with a triazole inhibitor (NSC799462/hexamer) | | Authors: | Nandi, P., DeVore, K., Chiu, P.-L. | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG
|
|
| PDBID: | 8uv4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uv8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uva | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uv7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uve | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8uvb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wze | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 sc9-10 strain: B18537) in complex with humanized nAb 5B11 (localized refinement) | | Authors: | Liu, L., Sun, H., Sun, Y., Zheng, Q., Li, S., Zheng, Z., Xia, N. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wzz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wzy | | Status: | HOLD -- hold until a certain date | | Title: | A novel amidohydrolase | | Authors: | Feng, R., Ma, D. | | Deposition date: | 2023-11-02 | | Release date: | 2024-11-02 |
|
| PDBID: | 8wzo | | Status: | HPUB -- hold until publication | | Title: | Parkin in complex with phospho NEDD8 | | Authors: | Lenka, D.R., Kumar, A. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wzn | | Status: | HPUB -- hold until publication | | Title: | ParkinK211N in complex with phospho NEDD8 | | Authors: | Lenka, D.R., Kumar, A. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8wzs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SRCRD11 of human DMBT1 from needle-shape crystal | | Authors: | Zhang, C., Lu, P., Nagata, K. | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
TAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPS
|
|
