| PDBID: | 8ux0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8ux3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1j | | Status: | HPUB -- hold until publication | | Title: | Study on the Mechanism of Dye Decolorizing Peroxidase Degradation of PVC | | Authors: | Zhang, Z., Yanng, D. | | Deposition date: | 2023-11-08 | | Sequence: | >Entity 1
MSQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKEANEEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQAL
>Entity 2
SQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFMLRFTKPVTGGYYFAPSLERIQAL
|
|
| PDBID: | 8x1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2p | | Status: | HPUB -- hold until publication | | Title: | YZwIdeal x16 a scaffold for cryo-EM of small proteins of interest crystallizing in space group 19 (P 21 21 21) | | Authors: | Moche, M., Friberg, O., Nygren, P.A., Nilvebrant, J. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2s | | Status: | HPUB -- hold until publication | | Title: | Heme-dependent l-tyrosine hydroxylase (TyrH) from Streptomyces sclerotialus: fourfold mutant | | Authors: | Carraretto, D., Mattevi, A. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2q | | Status: | HPUB -- hold until publication | | Title: | Mycobacterium tuberculosis fatty acyl CoA synthetase, FadD5 | | Authors: | Rahman, M.A., Dalwani, S., Venkatesan, R. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2r | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of the Mycobacterium tuberculosis fatty acyl CoA synthetase, FadD5 | | Authors: | Rahman, M.A., Dalwani, S., Venkatesan, R. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8r2n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the BeeR filament | | Authors: | Bergeron, J.R.C., Kollman, J.M. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8uwo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8uwn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CLK1 kinase in complex with compound 3 | | Authors: | Kim, J.L. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8uwq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of BT1282 GH18-like from Bacteroides thetaiotaomicron VPI-5482 | | Authors: | Sastre, D.E., Sultana, N., Navarro, M.V.A.S., Sundberg, E.J. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8uwr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human ACVR1 (ALK2) kinase in complex with compound 3 | | Authors: | Kim, J.L. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 7gqv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of PAS-GAF domain of the phytochrome from Deinococcus radiodurans at femto and picosecond timescales (-68 fs) | | Authors: | Shankar, M.K., Westenhoff, S. | | Deposition date: | 2023-11-07 |
|
