| PDBID: | 9n5i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n63 | | Status: | HPUB -- hold until publication | | Title: | Transporter associated with antigen processing (TAP) EQ mutant bound to ATP in the outward-facing open state | | Authors: | Lee, J., Chen, J. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n64 | | Status: | HPUB -- hold until publication | | Title: | Transporter associated with antigen processing (TAP) EQ mutant bound to ATP in the outward-facing kinked state | | Authors: | Lee, J., Chen, J. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5y | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin CA09 homotrimer bound to AEL31302/AEL31311 Fab | | Authors: | Fernandez-Quintero, M.L., Turner, H.L. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5c | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, CMPCPP-bound | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5d | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, CMP added | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5e | | Status: | HOLD -- hold until a certain date | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, AMPCPP in E-site | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 | | Release date: | 2026-02-04 |
|
| PDBID: | 9n5f | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG in syn-conformation with added AMP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5g | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, ATP in both A- and E-site | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n65 | | Status: | HPUB -- hold until publication | | Title: | Transporter associated with antigen processing (TAP) bound to ATP and ADP In the inward-facing conformation | | Authors: | Lee, J., Manon, V., Chen, J. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n54 | | Status: | HPUB -- hold until publication | | Title: | Bipartite p63 NLS in complex with Importin Alpha 2 | | Authors: | Esmaeili, S., Swarbrick, C.M.D., Forwood, J.K. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7w | | Status: | HPUB -- hold until publication | | Title: | Extended and wrapped protein P7 dimers of dimers, the P1 layer and the RNA-dependent RNA polymerase P2 in transcribing particles of bacteriophage phi6 | | Authors: | Kumpula, E.-P., Ilca, S.L., Huiskonen, J.T. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i80 | | Status: | HPUB -- hold until publication | | Title: | LecA in complex with a tolcapone derivative glycomimetic | | Authors: | Varrot, A. | | Deposition date: | 2025-02-03 | | Sequence: | >Entity 1
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
| PDBID: | 9i7y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of KRasG13C in Complex with Nucleotide-based Covalent Inhibitor 7b | | Authors: | Niggenaber, J., Mueller, M.P., Rauh, D. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7z | | Status: | HPUB -- hold until publication | | Title: | LecA in complex with 2-fluoro non-carbohydrate glycomimetic | | Authors: | Varrot, A. | | Deposition date: | 2025-02-03 | | Sequence: | >Entity 1
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
|
|
| PDBID: | 9ls6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9ls5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n50 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4j | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rabbit TRPM3 in complex with CIM0216 at 18 degrees Celsius | | Authors: | Kumar, S., Lu, W., Du, J. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9n4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-03 |
|
